"La dificultad no debe ser un motivo para desistir sino un estímulo para continuar"

Compra el disco de Paqui Sánchez

Disfruta de la música de Paqui Sánchez donde quieras y cuando quieras comprando su disco.

Puedes comprar el disco Óyelo bien de Paqui Sánchez Galbarro de forma segura y al mejor precio.

Lolita by Vladimir Nabokov

Vladimir Nabokov Lolita Vladimir Nabokov Lolita to Véra 2 Lolita — Vladimir Nabokov Contents Foreword 3 Part One 5 Part Two 95 Vladimir Nabokov — On a book entitled Lolita 207 3 Vladimir Nabokov — Lolita Foreword “Lolita, or the Confession of a White Widowed Male,” such were the two titles under which the writer of the present note received the strange pages it preambulates. “Humbert Humbert,” their author, had died in legal captivity, of coronary thrombosis, on November 16, 1952, a few days before his trial was scheduled to start. His lawyer, my good friend and relation, Clarence Choate Clark, Esq., now of he District of Columbia bar, in asking me to edit the manuscript, based his request on a clause in his client’s will which empowered my eminent cousin to use his discretion in all matters pertaining to the preparation of “Lolita” for print. Mr. Clark’s decision may have been influencedbythefactthattheeditorofhischoicehad just been awarded the Poling Prize for a modest work (“Do the Senses make Sense?”) wherein certain morbid states and perversions had been discussed. My task proved simpler than either of us had anticipated. Save for the correction of obvious solecisms and a careful suppression of a few tenacious details that despite “H.H.”’s own effortsstillsubsistedinhistextassignpostsandtombstones(indicativeofplacesorpersonsthat taste would conceal and compassion spare), this remarkable memoir is presented intact. Its author’s bizarre cognomen is his own invention; and, of course, this mask — through which two hypnotic eyes seem to glow — had to remain unlifted in accordance with its wearer’s wish. While “Haze” only rhymes with the heroine’s real surname, her firstnameistoocloselyinterwound with the inmost fiberofthebooktoallowonetoalterit;nor(asthereaderwillperceive for himself) is there any practical necessity to do so. References to “H.H.”’s crime may be looked up by the inquisitive in the daily papers for September-October 1952; its cause and purpose would have continued to come under my reading lamp. For the benefitofold-fashionedreaderswhowishtofollowthedestiniesofthe“real”people beyond the “true” story, a few details may be given as received from Mr. “Windmuller,” of “Ramsdale,” who desires his identity suppressed so that “the long shadow of this sorry and sordid business” should not reach the community to which he is proud to belong. His daughter, “Louise,” is by now a college sophomore, “Mona Dahl” is a student in Paris. “Rita” has recently married the proprietor of a hotel in Florida. Mrs. “Richard F. Schiller” died in childbed, giving birth to a stillborn girl, on Christmas Day 1952, in Gray Star, a settlement 4 Lolita — Vladimir Nabokov in the remotest Northwest. “Vivian Darkbloom” has written a biography, “My Cue,” to be published shortly, and critics who have perused the manuscript call it her best book. Thecaretakers of the various cemeteries involved report that no ghosts walk. Viewed simply as a novel, “Lolita” deals with situations and emotions that would remain exasperatingly vague to the reader had their expression been etiolated by means of platitudinous evasions. True, not a single obscene term is to be found in the whole work; indeed, the robust philistine who is conditioned by modern conventions into accepting without qualms a lavish array of four-letter words in a banal novel, will be quite shocked by their absence here. If, however, for this paradoxical prude’s comfort, an editor attempted to dilute or omit scenes that a certain type of mind might call “aphrodisiac” (see in this respect the monumental decision rendered December 6, 1933, by Hon. John M. Woolsey in regard to another, considerably more outspoken, book), one would have to forego the publication of “Lolita” altogether, since those very scenes that one might ineptly accuse of sensuous existence of their own, are the most strictly functional ones in the development of a tragic tale tending unswervingly to nothing less than a moral apotheosis. Thecynicmaysaythatcommercialpornographymakesthe same claim; the learned may counter by asserting that “H.H.”’s impassioned confession is a tempest in a test tube; that at least 12% of American adult males — a “conservative” estimate according to Dr. Blanche Schwarzmann (verbal communication) — enjoy yearly, in one way or another, the special experience “H.H.” describes with such despair; that had our demented diarist gone, in the fatal summer of 1947, to a competent psycho-pathologist, there would have been no disaster; but then, neither would there have been this book. Thiscommentatormaybeexcusedforrepeatingwhathehasstressedinhisownbooksandlectures, namely that “offensive”isfrequentlybutasynonymfor“unusual;”andagreatworkofart is of course always original, and thus by its very nature should come as a more or less shocking surprise. I have no intention to glorify “H.H.” No doubt, he is horrible, he is abject, he is a shining example of moral leprosy, a mixture of ferocity and jocularity that betrays supreme misery perhaps, but is not conducive to attractiveness. He is ponderously capricious. Many of his casual opinions on the people and scenery of this country are ludicrous. A desperate honesty that throbs through his confession does not absolve him from sins of diabolical cunning. He is abnormal. He is not a gentleman. But how magically his singing violin can conjure up a tendresse, a compassion for Lolita that makes us entranced with the book while abhorring its author! As a case history, “Lolita” will become, no doubt, a classic in psychiatric circles. As a work of art, it transcends its expiatory aspects; and still more important to us than scientificsignificanceandliteraryworth,istheethicalimpactthebookshouldhaveontheseriousreader;for in this poignant personal study there lurks a general lesson; the wayward child, the egotistic mother, the panting maniac — these are not only vivid characters in a unique story: they warn us of dangerous trends; they point out potent evils. “Lolita” should make all of us — parents, social workers, educators — apply ourselves with still greater vigilance and vision to the task of bringing up a better generation in a safer world. Widworth, Mass. John Ray, Jr., Ph.D. August 5, 1955 Vladimir Nabokov — Lolita 5 Part One 1 Lolita, light of my life, fireofmyloins.Mysin,mysoul.Lo-lee-ta:thetipofthe tongue taking a trip of three steps down the palate to tap, at three, on the teeth. Lo. Lee. Ta. She was Lo, plain Lo, in the morning, standing four feet ten in one sock. She was Lola in slacks. She was Dolly at school. She was Dolores on the dotted line. But in my arms she was always Lolita. Did she have a precursor? She did, indeed she did. In point of fact, there might have been no Lolita at all had I not loved, one summer, a certain initial girl-child. In a princedom by the sea. Oh when? About as many years before Lolita was born as my age was that summer. You can always count on a murderer for a fancy prose style. Ladies and gentlemen of the jury, exhibit number one is what the seraphs, the misinformed, simple, noble-winged seraphs, envied. Look at this tangle of thorns. 2 I was born in ?9?0, in Paris. My father was a gentle, easy-going person, a salad of racial genes: a Swiss citizen, of mixed French and Austrian descent, with a dash of the Danube in his veins. I am going to pass around in a minute some lovely, glossy-blue picture-postcards. He owned a luxurious hotel on the Riviera. His father and two grandfathers had sold wine, jewels and silk, respectively. At thirty he married an English girl, daughter of Jerome Dunn, the alpinist, and granddaughter of two Dorset parsons, experts in obscure subjects — paleopedology and Aeolian harps, respectively. My 6 Lolita — Vladimir Nabokov very photogenic mother died in a freak accident (picnic, lightning) when I was three, and, save for a pocket of warmth in the darkest past, nothing of her subsists within the hollows and dells of memory, over which, if you can still stand my style (I am writing under observation), the sun of my infancy had set: surely, you all know those redolent remnants of day suspended, with the midges, about some hedge in bloom or suddenly entered and traversed by the rambler, at the bottom of a hill, in the summer dusk; a furry warmth, golden midges. My mother’s elder sister, Sybil, whom a cousin of my father’s had married and then neglected, served in my immediate family as a kind of unpaid governess and housekeeper. Somebody told me later that she had been in love with my father, and that he had lightheartedly taken advantage of it one rainy day and forgotten it by the time the weather cleared. I was extremely fond of her, despite the rigidity — the fatal rigidity — of some of her rules. Perhaps she wanted to make of me, in the fullness of time, a better widower than my father. Aunt Sybil had pink-rimmed azure eyes and a waxen complexion. She wrote poetry. She was poetically superstitious. She said she knew she would die soon after my sixteenth birthday, and did. Her husband, a great traveler in perfumes, spent most of his time in America, where eventually he founded a firmandacquiredabitofrealestate. I grew, a happy, healthy child in a bright would of illustrated books, clean sand, orange trees, friendly dogs, sea vistas and smiling faces. Around me the splendid Hotel Mirana revolved as a kind of private universe, a whitewashed cosmos within the blue greater one that blazed outside. From the aproned pot-scrubber to the flanneledpotentate, everybody liked me, everybody petted me. Elderly American ladies leaning on their canes listed towards me like towers of Pisa. Ruined Russian princesses who could not pay my father, bought me expensive bonbons. He, mon cher petit papa, took me out boating and biking, taught me to swim and dive and water-ski, read to me Don Quixote and Les Misérables, and I adored and respected him and felt glad for him whenever I overheard the servants discuss his various lady-friends, beautiful and kind beings who made much of me and cooed and shed precious tears over my cheerful motherlessness. I attended an English day school a few miles from home, and there I played rackets and fives,andgotexcellentmarks,andwasonperfecttermswithschoolmatesandteachers alike. TheonlydefinitesexualeventsthatI canrememberashavingoccurredbefore my thirteenth birthday (that is, before I firstsawmylittleAnnabel)were:asolemn, decorous and purely theoretical talk about pubertal surprises in the rose garden of the school with an American kid, the son of a then celebrated motion-picture actress whom he seldom saw in the three-dimensional world; and some interesting reactions on the part of my organism to certain photographs, pearl and umbra, with infinitelysoftpartings,inPichon’ssumptuousLe Beauté Humaine that that I had filchedfromunderamountainofmarble-bound Graphics in the hotel library. Later, in his delightful debonair manner, my father gave me all the information he thought I needed about sex; this was just before sending me, in the autumn of ?923, to a lycée Vladimir Nabokov — Lolita 7 in Lyon (where we were to spend three winters); but alas, in the summer of that year, he was touring Italy with Mme de R. and her daughter, and I had nobody to complain to, nobody to consult. 3 Annabel was, like the writer, of mixed parentage: half-English, half-Dutch, in her case. I remember her features far less distinctly today than I did a few years ago, before I knew Lolita. Therearetwokindsofvisualmemory:onewhenyouskillfullyrecreatean image in the laboratory of your mind, with your eyes open (and then I see Annabel in such general terms as: “honey-colored skin,” “think arms,” “brown bobbed hair,” “long lashes,” “big bright mouth”); and the other when you instantly evoke, with shut eyes, on the dark inner side of your eyelids, the objective, absolutely optical replica of a beloved face, a little ghost in natural colors (and this is how I see Lolita). Let me therefore primly limit myself, in describing Annabel, to saying she was a lovely child a few months my junior. Her parents were old friends of my aunt’s, and as stuffyasshe.Theyhadrenteda villanotfarfromHotelMirana.BaldbrownMr. Leigh and fat, powdered Mrs. Leigh (born Vanessa van Ness). How I loathed them! At first,AnnabelandItalkedofperipheralaffairs.Shekeptliftinghandfulsof finesandandlettingitpourthroughherfingers.Ourbrainswereturnedthewaythose of intelligent European preadolescents were in our day and set, and I doubt if much individual genius should be assigned to our interest in the plurality of inhabited worlds, competitive tennis, infinity,solipsismandsoon.Thesoftnessandfragilityof baby animals caused us the same intense pain. She wanted to be a nurse in some famished Asiatic country; I wanted to be a famous spy. All at once we were madly, clumsily, shamelessly, agonizingly in love with each other; hopelessly, I should add, because that frenzy of mutual possession might have been assuaged only by our actually imbibing and assimilating every particle of each other’s soul and flesh;buttherewewere,unableeventomateasslumchildrenwouldhave so easily found an opportunity to do. After one wild attempt we made to meet at night in her garden (of which more later), the only privacy we were allowed was to be out of earshot but not out of sight on the populous part of the plage. There,onthe soft sand, a few feet away from our elders, we would sprawl all morning, in a petrifiedparoxysmofdesire,andtakeadvantageofeveryblessedquirkinspaceandtimeto touch each other: her hand, half-hidden in the sand, would creep toward me, its slender brown fingerssleepwalkingnearerandnearer;then,heropalescentkneewouldstart on a long cautious journey; sometimes a chance rampart built by younger children granted us sufficientconcealmenttograzeeachother’ssaltylips;theseincomplete contacts drove our healthy and inexperienced young bodies to such a state of exasperation that not even the cold blue water, under which we still clawed at each other, could bring relief. 8 Lolita — Vladimir Nabokov Among some treasures I lost during the wanderings of my adult years, there was a snapshot taken by my aunt which showed Annabel, her parents and the staid, elderly, lame gentleman, a Dr. Cooper, who that same summer courted my aunt, grouped around a table in a sidewalk café. Annabel did not come out well, caught as she was in the act of bending over her chocolat glacé, and her thin bare shoulders and the parting in her hair were about all that could be identified(asIrememberthatpicture)amidthe sunny blur into which her lost loveliness graded; but I, sitting somewhat apart from the rest, came out with a kind of dramatic conspicuousness: a moody, beetle-browed boy in a dark sport shirt and well-tailored white shorts, his legs crossed, sitting in profile,lookingaway.Thatphotographwastakenonthelastdayofourfatalsummer and just a few minutes before we made our second and finalattempttothwartfate. Under the flimsiestofpretexts(thiswasourverylastchance,andnothingreallymattered) we escaped from the café to the beach, and found a desolate stretch of sand, and there, in the violet shadow of some red rocks forming a kind of cave, had a brief session of avid caresses, with somebody’s lost pair of sunglasses for only witness. I was on my knees, and on the point of possessing my darling, when two bearded bathers, the old man of the sea and his brother, came out of the sea with exclamations of ribald encouragement, and four months later she died of typhus in Corfu. 4 I leaf again and again through these miserable memories, and keep asking myself, was it then, in the glitter of that remote summer, that the rift in my life began; or was my excessive desire for that child only the firstevidenceofaninherentsingularity?When I try to analyze my own cravings, motives, actions and so forth, I surrender to a sort of retrospective imagination which feeds the analytic faculty with boundless alternatives and which causes each visualized route to fork and re-fork without end in the maddeningly complex prospect of my past. I am convinced, however, that in a certain magic and fateful way Lolita began with Annabel. I also know that the shock of Annabel’s death consolidated the frustration of that nightmare summer, made of it a permanent obstacle to any further romance throughout the cold years of my youth. Thespiritualandthephysicalhadbeenblendedinus with a perfection that must remain incomprehensible to the matter-of-fact, crude, standard-brained youngsters of today. Long after her death I felt her thoughts floating through mine. Long before we met we had had the same dreams. We compared notes. We found strange affinities.ThesameJuneof thesameyear(?9?9)astraycanary had flutteredintoherhouseandmine,intwowidelyseparatedcountries.Oh,Lolita, had you loved me thus! I have reserved for the conclusion of my “Annabel” phase the account of our unsuccessful firsttryst.Onenight,shemanagedtodeceivetheviciousvigilanceofherfamily. In a nervous and slender-leaved mimosa grove at the back of their villa we Vladimir Nabokov — Lolita 9 found a perch on the ruins of a low stone wall. Throughthedarknessandthetendertrees we could see the arabesques of lighted windows which, touched up by the colored inks of sensitive memory, appear to me now like playing cards — presumably because a bridge game was keeping the enemy busy. She trembled and twitched as I kissed the corner of her parted lips and the hot lobe of her ear. A cluster of stars palely glowed above us, between the silhouettes of long thin leaves; that vibrant sky seemed as naked as she was under her light frock. I saw her face in the sky, strangely distinct, as if it emitted a faint radiance of its own. Her legs, her lovely live legs, were not too close together, and when my hand located what it sought, a dreamy and eerie expression, half-pleasure, half-pain, came over those childish features. She sat a little higher than I, and whenever in her solitary ecstasy she was led to kiss me, her head would bend with a sleepy, soft, drooping movement that was almost woeful, and her bare knees caught and compressed my wrist, and slackened again; and her quivering mouth, distorted by the acridity of some mysterious potion, with a sibilant intake of breath came near to my face. She would try to relieve the pain of love by firstroughlyrubbing her dry lips against mine; then my darling would draw away with a nervous toss of her hair, and then again come darkly near and let me feed on her open mouth, while with a generosity that was ready to offerhereverything,myheart,mythroat,my entrails, I have her to hold in her awkward fistthescepterofmypassion. I recall the scent of some kind of toilet powder — I believe she stole it from her mother’s Spanish maid — a sweetish, lowly, musky perfume. It mingled with her own biscuity odor, and my senses were suddenly filledtothebrim;asuddencommotion in a nearby bush prevented them from overflowing—andaswedrewawayfrom each other, and with aching veins attended to what was probably a prowling cat, there came from the house her mother’s voice calling her, with a rising frantic note — and Dr. Cooper ponderously limped out into the garden. But that mimosa grove — the haze of stars, the tingle, the flame,thehoney-dew,andtheacheremainedwith me, and that little girl with her seaside limbs and ardent tongue haunted me ever since — until at last, twenty-four years later, I broke her spell by incarnating her in another. 5 Thedaysofmyyouth,asIlookbackonthem,seemtoflyawayfrommeina flurryof pale repetitive scraps like those morning snow storms of used tissue paper that a train passenger sees whirling in the wake of the observation car. In my sanitary relations with women I was practical, ironical and brisk. While a college student, in London and Paris, paid ladies sufficedme.Mystudiesweremeticulousandintense,althoughnot particularly fruitful. At first,Iplannedtotakeadegreeinpsychiatryandmanymanqué talents do; but I was even more manqué than that; a peculiar exhaustion, I am so oppressed, doctor, set in; and I switched to English literature, where so many frus10 Lolita — Vladimir Nabokov trated poets end as pipe-smoking teachers in tweeds. Paris suited me. I discussed Soviet movies with expatriates. I sat with uranists in the Deux Magots. I published tortuous essays in obscure journals. I composed pastiches: …Fräulein von Kulp may turn, her hand upon the door; I will not follow her. Nor Fresca. Nor that Gull. A paper of mine entitled “TheProustianthemeinaletterfromKeatstoBenjaminBailey” was chuckled over by the six or seven scholars who read it. I launched upon an “Histoire abrégée de la poésie anglaise” for a prominent publishing firm,andthenstarted to compile that manual of French literature for English-speaking students (with comparisons drawn from English writers) which was to occupy me throughout the forties — and the last volume of which was almost ready for press by the time of my arrest. I found a job — teaching English to a group of adults in Auteuil. Thenaschoolforboys employed me for a couple of winters. Now and then I took advantage of the acquaintances I had formed among social workers and psychotherapists to visit in their company various institutions, such as orphanages and reform schools, where pale pubescent girls with matted eyelashes could be stared at in perfect impunity remindful of that granted one in dreams. Now I wish to introduce the following idea. Between the age limits of nine and fourteen there occur maidens who, to certain bewitched travelers, twice or many times older than they, reveal their true nature which is not human, but nymphic (that is, demoniac); and these chosen creatures I propose to designate as “nymphets.” It will be marked that I substitute time terms for spatial ones. In fact, I would have the reader see “nine” and “fourteen” as the boundaries — the mirrory beaches and rosy rocks — of an enchanted island haunted by those nymphets of mine and surrounded by a vast, misty sea. Between those age limits, are all girl-children nymphets? Of course not. Otherwise, we who are in the know, we lone voyagers, we nympholepts, would have long gone insane. Neither are good looks any criterion; and vulgarity, or at least what a given community terms so, does not necessarily impair certain mysterious characteristics, the fey grace, the elusive, shifty, soul-shattering, insidious charm that separates the nymphet from such coevals of hers as are incomparably more dependent on the spatial world of synchronous phenomena than on that intangible island of entranced time where Lolita plays with her likes. Within the same age limits the number of true nymphets is trickingly inferior to that of provisionally plain, or just nice, or “cute,” or even “sweet” and “attractive,” ordinary, plumpish, formless, cold-skinned, essentially human little girls, with tummies and pigtails, who may or may not turn into adults of great beauty (look at the ugly dumplings in black stockings and white hats that are metamorphosed into stunning stars of the screen). A normal man given Vladimir Nabokov — Lolita 11 a group photograph of school girls or Girl Scouts and asked to point out the comeliest one will not necessarily choose the nymphet among them. You have to be an artist and a madman, a creature of infinitemelancholy,withabubbleofhotpoisoninyour loins and a super-voluptuous flamepermanentlyaglowinyoursubtlespine(oh,how you have to cringe and hide!), in order to discern at once, by ineffablesigns—theslightly feline outline of a cheekbone, the slenderness of a downy limb, and other indices which despair and shame and tears of tenderness forbid me to tabulate — the little deadly demon among the wholesome children; she stands unrecognized by them and unconscious herself of her fantastic power. Furthermore, since the idea of time plays such a magic part in the matter, the student should not be surprised to learn that there must be a gap of several years, never less than ten I should say, generally thirty or forty, and as many as ninety in a few known cases, between maiden and man to enable the latter to come under a nymphet’s spell. It is a question of focal adjustment, of a certain distance that the inner eye thrills to surmount, and a certain contrast that the mind perceives with a gasp of perverse delight. When I was a child and she was a child, my little Annabel was no nymphet to me; I was her equal, a faunlet in my own right, on that same enchanted island of time; but today, in September ?952, after twenty-nine years have elapsed, I think I can distinguish in her the initial fateful elf in my life. We loved each other with a premature love, marked by a fiercenessthatsooftendestroysadultlives.Iwasastrongladand survived; but the poison was in the wound, and the wound remained ever open, and soon I found myself maturing amid a civilization which allows a man of twenty-fivetocourtagirlofsixteenbutnotagirloftwelve. No wonder, then, that my adult life during the European period of my existence proved monstrously twofold. Overtly, I had so-called normal relationships with a number of terrestrial women having pumpkins or pears for breasts; inly, I was consumed by a hell furnace of localized lust for every passing nymphet whom as a law-abiding poltroon I never dared approach. ThehumanfemalesIwasallowedtowieldwerebutpalliative agents. I am ready to believe that the sensations I derived from natural fornication were much the same as those known to normal big males consorting with their normal big mates in that routine rhythm which shakes the world. Thetroublewasthatthose gentlemen had not, and I had, caught glimpses of an incomparably more poignant bliss. Thedimmestofmypollutivedreamswasathousandtimesmoredazzlingthan all the adultery the most virile writer of genius or the most talented impotent might imagine. My world was split. I was aware of not one but two sexes, neither of which was mine; both would be termed female by the anatomist. But to me, through the prism of my senses, “they were as differentasmistandmast.”AllthisIrationalize now. In my twenties and early thirties, I did not understand my throes quite so clearly. While my body knew what it craved for, my mind rejected my body’s every plea. One moment I was ashamed and frightened, another recklessly optimistic. Taboos strangulated me. Psychoanalysts wooed me with pseudoliberations of pseudolibidoes. ThefactthattometheonlyobjectofamoroustremorweresistersofAnnabel’s, 12 Lolita — Vladimir Nabokov her handmaids and girl-pages, appeared to me at times as a forerunner of insanity. At other times I would tell myself that it was all a question of attitude, that there was really nothing wrong in being moved to distraction by girl-children. Let me remind my reader that in England, with the passage of the Children and Young Person Act in ?933, the term “girl-child” is definedas“agirlwhoisovereightbutunderfourteenyears” (after that, from fourteen to seventeen, the statutory definitionis“youngperson”). In Massachusetts, U.S., on the other hand, a “wayward child” is, technically, one “between seven and seventeen years of age” (who, moreover, habitually associates with vicious or immoral persons). Hugh Broughton, a writer of controversy in the reign of James the First, has proved that Rahab was a harlot at ten years of age. Thisisallvery interesting, and I daresay you see me already frothing at the mouth in a fit;butno, I am not; I am just winking happy thoughts into a little tiddle cup. Here are some more pictures. Here is Virgil who could the nymphet sing in a single tone, but probably preferred a lad’s perineum. Here are two of King Akhnaten’s and Queen Nefertiti’s pre-nubile Nile daughters (that royal couple had a litter of six), wearing nothing but many necklaces of bright beads, relaxed on cushions, intact after three thousand years, with their soft brown puppybodies, cropped hair and long ebony eyes. Here are some brides of ten compelled to seat themselves on the fascinum, the virile ivory in the temples of classical scholarship. Marriage and cohabitation before the age of puberty are still not uncommon in certain East Indian provinces. Lepcha old men of eighty copulate with girls of eight, and nobody minds. After all, Dante fell madly in love with Beatrice when she was nine, a sparkling girleen, painted and lovely, and bejeweled, in a crimson frock, and this was in ?274, in Florence, at a private feast in the merry month of May. And when Petrarch fell madly in love with his Laureen, she was a fair-haired nymphet of twelve running in the wind, in the pollen and dust, a flowerinflight,inthebeautifulplainasdescriedfromthehillsofVaucluse. But let us be prim and civilized. Humbert Humbert tried hard to be good. Really and truly, he id. He had the utmost respect for ordinary children, with their purity and vulnerability, and under no circumstances would he have interfered with the innocence of a child, if there was the least risk of a row. But how his heart beat when, among the innocent throng, he espied a demon child, “enfant charmante et fourbe,” dim eyes, bright lips, ten years in jail if you only show her you are looking at her. So life went. Humbert was perfectly capable of intercourse with Eve, but it was Lilith he longed for. Thebud-stageofbreastdevelopmentappearsearly(?0.7years)inthesequence of somatic changes accompanying pubescence. And the next maturational item available is the firstappearanceofpigmentedpubichair(??.2years).Mylittlecup brims with tiddles. A shipwreck. An atoll. Alone with a drowned passenger’s shivering child. Darling, this is only a game! How marvelous were my fancied adventures as I sat on a hard park bench pretending to be immersed in a trembling book. Around the quiet scholar, nymphets played freely, as if he were a familiar statue or part of an old tree’s shadow and sheen. Once a perfect little beauty in a tartan frock, with a clatter put her heavVladimir Nabokov — Lolita 13 ily armed foot near me upon the bench to dip her slim bare arms into me and tighten the strap of her roller skate, and I dissolved in the sun, with my book for figleaf,asher auburn ringlets fell all over her skinned knee, and the shadow of leaves I shared pulsated and melted on her radiant limb next to my chameloenic cheek. Another time a red-haired school girl hung over me in the metro, and a revelation of axillary russet I obtained remained in my blood for weeks. I could list a great number of these one-sided diminutive romances. Some of them ended in a rich flavorofhell.Ithappenedfor instance that from my balcony I would notice a lighted window across the street and what looked like a nymphet in the act of undressing before a co-operative mirror. Thusisolated,thusremoved,thevisionacquiredanespeciallykeencharmthatmademe race with all speed toward my lone gratification.Butabruptly,fiendishly,thetender pattern of nudity I had adored would be transformed into the disgusting lamp-lit bare arm of a man in his underclothes reading his paper by the open window in the hot, damp, hopeless summer night. Rope-skipping, hopscotch. Thatoldwomaninblackwhosatdownnexttomeonmy bench, on my rack of joy (a nymphet was groping under me for a lost marble), and asked if I had stomachache, the insolent hag. Ah, leave me alone in my pubescent park, in my mossy garden. Let them play around me forever. Never grow up. 6 A propos: I have often wondered what became of those nymphets later? In this wrought-iron would of criss-cross cause and effect,coulditbethatthehiddenthrobI stole from them did not affecttheirfuture?Ihadpossessedher—andsheneverknewit. All right. But would it not tell sometime later? Had I not somehow tampered with her fate by involving her image in my voluptas? Oh, it was, and remains, a source of great and terrible wonder. I learned, however, what they looked like, those lovely, maddening, thin-armed nymphets, when they grew up. I remember walking along an animated street on a gray spring afternoon somewhere near the Madeleine. A short slim girl passed me at a rapid, high-heeled, tripping step, we glanced back at the same moment, she stopped and I accosted her. She came hardly up to my chest hair and had the kind of dimpled round little face French girls so often have, and I liked her long lashes and tight-fitting tailored dress sheathing in pearl-gray her young body which still retained — and that was the nymphic echo, the chill of delight, the leap in my loins — a childish something mingling with the professional frétillement of her small agile rump. I asked her price, and she promptly replied with melodious silvery precision (a bird, a very bird!) “Cent.” I tried to haggle but she saw the awful lone longing in my lowered eyes, directed so far down at her round forehead and rudimentary hat (a band, a posy); and with one beat of her lashes: “Tant pis,” she said, and made as if to move away. Perhaps only three years earlier I might have seen her coming home from school! That 14 Lolita — Vladimir Nabokov evocation settled the matter. She led me up the usual steep stairs, with the usual bell clearing the way for the monsieur who might not care to meet another monsieur, on the mournful climb to the abject room, all bed and bidet. As usual, she asked at once for her petit cadeau, and as usual I asked her name (Monique) and her age (eighteen). I was pretty well acquainted with the banal way of streetwalkers. Theyallanswer“dix-huit” — a trim twitter, a note of finalityandwistfuldeceitwhichtheyemituptotentimes per day, the poor little creatures. But in Monique’s case there could be no doubt she was, if anything, adding one or two years to her age. ThisIdeducedfrommanydetails of her compact, neat, curiously immature body. Having shed her clothes with fascinating rapidity, she stood for a moment partly wrapped in the dingy gauze of the window curtain listening with infantile pleasure, as pat as pat could be, to an organ-grinder in the dust-brimming courtyard below. When I examined her small hands and drew her attention to their grubby fingernails,shesaidwithanaïvefrown“Oui, ce n’est pas bien,” and went to the wash-basin, but I said it did not matter, did not matter at all. With her brown bobbed hair, luminous gray eyes and pale skin, she looked perfectly charming. Her hips were no bigger than those of a squatting lad; in fact, I do not hesitate to say (and indeed this is the reason why I linger gratefully in that gauze-gray room of memory with little Monique) that among the eighty or so grues I had had operate upon me, she was the only one that gave me a pang of genuine pleasure. “Il était malin, celui qui a inventé ce truc-là,” she commented amiably, and got back into her clothes with the same high-style speed. I asked for another, more elaborate, assignment later the same evening, and she said she would meet me at the corner café at nine, and swore she had never posé un lapin in all her young life. We returned to the same room, and I could not help saying how very pretty she was to which she answered demurely: “Tu es bien gentil de dire ça” and then, noticing what I noticed too in the mirror reflectingoursmallEden—thedreadful grimace of clenched-teeth tenderness that distorted my mouth — dutiful little Monique (oh, she had been a nymphet, all right!) wanted to know if she should remove the layer of red from her lips avant qu’on se couche in case I planned to kiss her. Of course, I planned it. I let myself go with her more completely than I had with any young lady before, and my last vision that night of long-lashed Monique is touched up with a gaiety that I findseldomassociatedwithanyeventinmyhumiliating,sordid, taciturn love life. She looked tremendously pleased with the bonus of fiftyIgaveher as she trotted out into the April night drizzle with Humbert Humbert lumbering in her narrow wake. Stopping before a window display she said with great gusto: “Je vais m’acheter des bas!” and never may I forget the way her Parisian childish lips exploded on “bas,” pronouncing it with an appetite that all but changed the “a” into a brief buoyant bursting “o” as in “bot”. I had a date with her next day at 2.?5 p.m. in my own rooms, but it was less successful, she seemed to have grown less juvenile, more of a woman overnight. A cold I caught from her led me to cancel a fourth assignment, nor was I sorry to break an emotional series that threatened to burden me with heart-rending fantasies and Vladimir Nabokov — Lolita 15 peter out in dull disappointment. So let her remain, sleek, slender Monique, as she was for a minute or two: a delinquent nymphet shining through the matter-of-fact young whore. My brief acquaintance with her started a train of thought that may seem pretty obvious to the reader who knows the ropes. An advertisement in a lewd magazine landed me, one brave day, in the officeofa MlleEdithwhobeganbyofferingme to choosea kindred soul from a collection of rather formal photographs in a rather soiled album (“Regardez-moi cette belle brune!”). When I pushed the album away and somehow managed to blurt out my criminal craving, she looked as if about to show me the door; however, after asking me what price I was prepared to disburse, she condescended to put me in touch with a person qui pourrait arranger la chose. Next day, an asthmatic woman, coarsely painted, garrulous, garlicky, with an almost farcical Provencal accent and a black mustache above a purple lip, took me to what was apparently her own domicile, and there, after explosively kissing the bunched tips of her fat fingerstosignify the delectable rosebud quality of her merchandise, she theatrically drew aside a curtain to reveal what I judged was that part of the room where a large and unfastidious family usually slept. It was now empty save for a monstrously plump, sallow, repulsively plain girl of at least fifteenwithred-ribbonedthickblackbraidswhosaton a chair perfunctorily nursing a bald doll. When I shook my head and tried to shuffleoutofthetrap,thewoman,talkingfast,beganremovingthedingywoolenjerseyfrom the young giantess’ torso; then, seeing my determination to leave, she demanded son argent. A door at the end of the room was opened, and two men who had been dining in the kitchen joined in the squabble. Theyweremisshapen,bare-necked,veryswarthy and one of them wore dark glasses. A small boy and a begrimed, bowlegged toddler lurked behind them. With the insolent logic of a nightmare, the enraged procuress, indicating the man in glasses, said he had served in the police, lui, so that I had better do as I was told. I went up to Marie — for that was her stellar name — who by then had quietly transferred her heavy haunches to a stool at the kitchen table and resumed her interrupted soup while the toddler picked up the doll. With a surge of pity dramatizing my idiotic gesture, I thrust a banknote into her indifferenthand.Shesurrendered my gift to the ex-detective, whereupon I was sufferedtoleave. 7 I do not know if the pimp’s album may not have been another link in the daisy-chain; but soon after, for my own safety, I decided to marry. It occurred to me that regular hours, home-cooked meals, all the conventions of marriage, the prophylactic routine of its bedroom activities and, who knows, the eventual floweringofcertainmoralvalues, of certain spiritual substitutes, might help me, if not to purge myself of my degrading and dangerous desires, at least to keep them under pacificcontrol.Alittlemoney that had come my way after my father’s death (nothing very grand — the Mi16 Lolita — Vladimir Nabokov rana had been sold long before), in addition to my striking if somewhat brutal good looks, allowed me to enter upon my quest with equanimity. After considerable deliberation, my choice fell on the daughter of a Polish doctor: the good man happened to be treating me for spells of dizziness and tachycardia. We played chess; his daughter watched me from behind her easel, and inserted eyes or knuckles borrowed from me into the cubistic trash that accomplished misses then painted instead of lilacs and lambs. Let me repeat with quiet force: I was, and still am, despite mes malheurs, an exceptionally handsome male; slow-moving, tall, with soft dark hair and a gloomy but all the more seductive cast of demeanor. Exceptional virility often reflectsinthesubject’s displayable features a sullen and congested something that pertains to what he has to conceal. And this was my case. Well did I know, alas, that I could obtain at the snap of my fingersanyadultfemaleIchose;infact,ithadbecomequiteahabitwith me of not being too attentive to women lest they come toppling, bloodripe, into my cold lap. Had I been a français moyen with a taste for flashyladies,Imighthaveeasily found, among the many crazed beauties that lashed my grim rock, creatures far more fascinating than Valeria. My choice, however, was prompted by considerations whose essence was, as I realized too late, a piteous compromise. All of which goes to show how dreadfully stupid poor Humbert always was in matters of sex. 8 Although I told myself I was looking merely for a soothing presence, a glorifiedpot-au-feu, an animated merkin, what really attracted me to Valeria was the imitation she gave of a little girl. She gave it not because she had divined something about me; it was just her style — and I fell for it. Actually, she was at least in her late twenties (I never established her exact age for even her passport lied) and had mislaid her virginity under circumstances that changed with her reminiscent moods. I, on my part, was as naïve as only a pervert can be. She looked fluffyandfrolicsome,dressedà la gamine, showed a generous amount of smooth leg, knew how to stress the white of a bare instep by the black of a velvet slipper, and pouted, and dimpled, and romped, and dirndled, and shook her short curly blond hair in the cutest and tritest fashion imaginable. After a brief ceremony at the mairie, I tool her to the new apartment I had rented and, somewhat to her surprise, had her wear, before I touched her, a girl’s plain nightshirt that I had managed to filchfromthelinenclosetofanorphanage.Iderivedsome fun from that nuptial night and had the idiot in hysterics by sunrise. But reality soon asserted itself. Thebleachedcurlrevealeditsmelanicroot;thedownturnedtoprickles on a shaved shin; the mobile moist mouth, no matter how I stuffeditwithlove, disclosed ignominiously its resemblance to the corresponding part in a treasured portrait of her toadlike dead mama; and presently, instead of a pale little gutter girl, Humbert Humbert had on his hands a large, puffy,short-legged,big-breastedandpractically brainless baba. Vladimir Nabokov — Lolita 17 Thisstateofaffairslastedfrom?935to?939.Heronlyassetwasa mutednaturewhich did help to produce an odd sense of comfort in our small squalid flat:tworooms,a hazy view in one window, a brick wall in the other, a tiny kitchen, a shoe-shaped bath tub, within which I felt like Marat but with no white-necked maiden to stab me. We had quite a few cozy evenings together, she deep in her Paris-Soir, I working at a rickety table. We went to movies, bicycle races and boxing matches. I appealed to her stale fleshveryseldom,onlyincasesofgreaturgencyanddespair.Thegroceropposite had a little daughter whose shadow drove me mad; but with Valeria’s help I did findafterallsomelegaloutletstomyfantasticpredicament.Astocooking,wetacitly dismissed the pot-au-feu and had most of our meals at a crowded place in rue Bonaparte where there were wine stains on the table cloth and a good deal of foreign babble. And next door, an art dealer displayed in his cluttered window a splendid, flamboyant,green,red,goldenandinkyblue,ancientAmericanestampe—alocomotive with a gigantic smokestack, great baroque lamps and a tremendous cowcatcher, hauling its mauve coaches through the stormy prairie night and mixing a lot of spark-studded black smoke with the furry thunder clouds. Theseburst.Inthesummerof?939mon oncle d’Amérique died bequeathing me an annual income of a few thousand dollars on condition I came to live in the States and showed some interest in his business. Thisprospectwasmostwelcometome.I felt my life needed a shake-up. Therewasanotherthing,too:mothholeshadappeared in the plush of matrimonial comfort. During the last weeks I had kept noticing that my fat Valeria was not her usual self; had acquired a queer restlessness; even showed something like irritation at times, which was quite out of keeping with the stock character she was supposed to impersonate. When I informed her we were shortly to sail for New York, she looked distressed and bewildered. Thereweresometedious difficultieswithherpapers.Shehada Nansen,orbettersayNonsense,passport which for some reason a share in her husband’s solid Swiss citizenship could not easily transcend; and I decided it was the necessity of queuing in the préfecture, and other formalities, that had made her so listless, despite my patiently describing to her America, the country of rosy children and great trees, where life would be such an improvement on dull dingy Paris. We were coming out of some officebuildingonemorning,withherpapersalmost in order, when Valeria, as she waddled by my side, began to shake her poodle head vigorously without saying a word. I let her go on for a while and then asked if she thought she had something inside. She answered (I translate from her French which was, I imagine, a translation in its turn of some Slavic platitude): “Thereisanother man in my life.” Now, these are ugly words for a husband to hear. Theydazedme,Iconfess.Tobeat her up in the street, there and then, as an honest vulgarian might have done, was not feasible. Years of secret sufferingshadtaughtmesuperhumanself-control.SoI ushered her into a taxi which had been invitingly creeping along the curb for some time, and in this comparative privacy I quietly suggested she comment her wild talk. 18 Lolita — Vladimir Nabokov A mounting fury was suffocatingme—notbecauseIhadanyparticularfondnessforthat figureoffun, Mme Humbert, but because matters of legal and illegal conjunction were for me alone to decide, and here she was, Valeria, the comedy wife, brazenly preparing to dispose in her own way of my comfort and fate. I demanded her lover’s name. I repeated my question; but she kept up a burlesque babble, discoursing on her unhappiness with me and announcing plans for an immediate divorce. “Mais qui est-ce?” I shouted at last, striking her on the knee with my fist;andshe,withoutevenwincing,stared at me as if the answer were too simple for words, then gave a quick shrug and pointed at the thick neck of the taxi driver. He pulled up at a small café and introduced himself. I do not remember his ridiculous name but after all those years I still see him quite clearly — a stocky White Russian ex-colonel with a bushy mustache and a crew cut; there were thousands of them plying that fool’s trade in Paris. We sat down at a table; the Tsarist ordered wine, and Valeria, after applying a wet napkin to her knee, went on talking — into me rather than to me; she poured words into this dignifiedreceptaclewithavolubilityIhadneversuspectedshehadinher.Andeverynow and then she would volley a burst of Slavic at her stolid lover. Thesituationwaspreposterous and became even more so when the taxi-colonel, stopping Valeria with a possessive smile, began to unfold his views and plans. With an atrocious accent to his careful French, he delineated the world of love and work into which he proposed to enter hand in hand with his child-wife Valeria. She by now was preening herself, between him and me, rouging her pursed lips, tripling her chin to pick at her blouse-bosom and so forth, and he spoke of her as if she were absent, and also as if she were a kind of little ward that was in the act of being transferred, for her own good, from one wise guardian to another even wiser one; and although my helpless wrath may have exaggerated and disfiguredcertainimpressions,Icanswearthatheactuallyconsulted me on such things as her diet, her periods, her wardrobe and the books she had read or should read. “I think,” — he said, “She will like Jean Christophe?” Oh, he was quite a scholar, Mr. Taxovich. I put an end to this gibberish by suggesting Valeria pack up her few belongings immediately, upon which the platitudinous colonel gallantly offeredtocarrythemintothe car. Reverting to his professional state, he drove the Humberts to their residence and all the way Valeria talked, and Humbert the Terrible deliberated with Humbert the Small whether Humbert Humbert should kill her or her lover, or both, or neither. I remember once handling an automatic belonging to a fellow student, in the days (I have not spoken of them, I think, but never mind) when I toyed with the idea of enjoying his little sister, a most diaphanous nymphet with a black hair bow, and then shooting myself. I now wondered if Valechka (as the colonel called her) was really worth shooting, or strangling, or drowning. She had very vulnerable legs, and I decided I would limit myself to hurting her very horribly as soon as we were alone. But we never were. Valechka — by now shedding torrents of tears tinged with the mess of her rainbow make-up, — started to fillanyhowatrunk,andtwosuitcases,and a bursting carton, and visions of putting on my mountain boots and taking a runVladimir Nabokov — Lolita 19 ning kick at her rump were of course impossible to put into execution with the cursed colonel hovering around all the time. I cannot say he behaved insolently or anything like that; on the contrary, he displayed, as a small sideshow in the theatricals I had been inveigled in, a discreet old-world civility, punctuating his movements with all sorts of mispronounced apologies (j’ai demande pardonne — excuse me — est-ce que j’ai puis — may I — and so forth), and turning away tactfully when Valechka took down with a flourishherpinkpantiesfromtheclotheslineabovethetub;butheseemedtobe all over the place at once, le gredin, agreeing his frame with the anatomy of the flat,reading in my chair my newspaper, untying a knotted string, rolling a cigarette, counting the teaspoons, visiting the bathroom, helping his moll to wrap up the electric fan her father had given her, and carrying streetward her luggage. I sat with arms folded, one hip on the window sill, dying of hate and boredom. At last both were out of the quivering apartment — the vibration of the door I had slammed after them still rang in my every nerve, a poor substitute for the backhand slap with which I ought to have hit her across the cheekbone according to the rules of the movies. Clumsily playing my part, I stomped to the bathroom to check if they had taken my English toilet water; they had not; but I noticed with a spasm of fiercedisgustthattheformerCounselor of the Tsar, after thoroughly easing his bladder, had not flushedthetoilet. Thatsolemnpoolofalienurinewithasoggy,tawnycigarettebuttdisintegratingin it struck me as a crowning insult, and I wildly looked around for a weapon. Actually I daresay it was nothing but middle-class Russian courtesy (with an oriental tang, perhaps) that had prompted the good colonel (Maximovich! his name suddenly taxies back to me), a very formal person as they all are, to mufflehisprivateneedindecorous silence so as not to underscore the small size of his host’s domicile with the rush of a gross cascade on top of his own hushed trickle. But this did not enter my mind at the moment, as groaning with rage I ransacked the kitchen for something better than a broom. Then,cancelingmysearch,Idashedoutofthehousewiththeheroicdecision of attacking him barefisted;despitemynaturalvigor,Iamnopugilist,whilethe short but broad-shouldered Maximovich seemed made of pig iron. Thevoidofthe street, revealing nothing of my wife’s departure except a rhinestone button that she had dropped in the mud after preserving it for three unnecessary years in a broken box, may have spared me a bloody nose. But no matter. I had my little revenge in due time. A man from Pasadena told me one day that Mrs. Maximovich née Zborovski had died in childbirth around ?945; the couple had somehow got over to California and had been used there, for an excellent salary, in a year-long experiment conducted by a distinguished American ethnologist. Theexperimentdealtwithhuman and racial reactions to a diet of bananas and dates in a constant position on all fours. My informant, a doctor, swore he had seen with his own eyes obese Valechka and her colonel, by then gray-haired and also quite corpulent, diligently crawling about the well-swept floorsofabrightlylitsetofrooms(fruitinone,waterinanother,matsin a third and so on) in the company of several other hired quadrupeds, selected from indigent and helpless groups. I tried to findtheresultsofthesetestsintheReview of 20 Lolita — Vladimir Nabokov Anthropology; but they appear not to have been published yet. Thesescientificproducts take of course some time to fructuate. I hope they will be illustrated with photographs when they do get printed, although it is not very likely that a prison library will harbor such erudite works. TheonetowhichIamrestrictedthesedays,despitemy lawyer’s favors, is a good example of the inane eclecticism governing the selection of books in prison libraries. TheyhavetheBible,ofcourse,andDickens(anancient set, N.Y., G.W. Dillingham, Publisher, MDCCCLXXXVII); and the Children’s Encyclopedia (with some nice photographs of sunshine-haired Girl Scouts in shorts), and A Murder Is Announced by Agatha Christie; but they also have such coruscating triflesasA vagabond in Italy by Percy Elphinstone, author of Venice Revisited, Boston, ?868, and a comparatively recent (?946) Who’s Who in the Limelight — actors, producers, playwrights, and shots of static scenes. In looking through the latter volume, I was treated last night to one of those dazzling coincidences that logicians loathe and poets love. I transcribe most of the page: Pym, Roland. Born in Lundy, Mass., ?922. Received stage training at Elsinore Playhouse, Derby, N.Y. Made debut in Sunburst. Among his many appearances are Two Blocks from Here, TheGirlinGreen,ScrambledHusbands,TheStrangeMushroom,Touchand Go, John Lovely, I Was Dreaming of You. Quilty, Clare, American dramatist. Born in Ocean City, N.J., ?9??. Educated at Columbia University. Started on a commercial career but turned to playwriting. Author of TheLittleNymph,TheLadyWhoLovedLightning(in collaboration with Vivian Darkbloom), Dark Age, ThestrangeMushroom,FatherlyLove, and others. His many plays for children are notable. Little Nymph (?940) traveled ?4,000 miles and played 280 performances on the road during the winter before ending in New York. Hobbies: fast cars, photography, pets. Quine, Dolores. Born in ?882, in Dayton, Ohio. Studied for stage at American Academy. First played in Ottawa in ?900. Made New York debut in ?904 in Never Talk to Strangers. Has disappeared since in [a list of some thirty plays follows]. How the look of my dear love’s name even affixedtosomeoldhagofanactress,still makes me rock with helpless pain! Perhaps, she might have been an actress too. Born ?935. Appeared (I notice the slip of my pen in the preceding paragraph, but please do not correct it, Clarence) in TheMurderedPlaywright. Quine the Swine. Guilty of killing Quilty. Oh, my Lolita, I have only words to play with! Vladimir Nabokov — Lolita 21 9 Divorce proceedings delayed my voyage, and the gloom of yet another World War had settled upon the globe when, after a winter of ennui and pneumonia in Portugal, I at last reached the States. In New York I eagerly accepted the soft job fate offeredme: it consisted mainly of thinking up and editing perfume ads. I welcomed its desultory character and pseudoliterary aspects, attending to it whenever I had nothing better to do. On the other hand, I was urged by a war-time university in New York to complete my comparative history of French literature for English-speaking students. Thefirstvolumetookmea coupleofyearsduringwhichI putinseldomlessthanfifteen hours of work daily. As I look back on those days, I see them divided tidily into ample light and narrow shade: the light pertaining to the solace of research in palatial libraries, the shade to my excruciating desires and insomnias of which enough has been said. Knowing me by now, the reader can easily imagine how dusty and hot I got, trying to catch a glimpse of nymphets (alas, always remote) playing in Central Park, and how repulsed I was by the glitter of deodorized career girls that a gay dog in one of the officeskeptunloadinguponme.Letusskipallthat.A dreadfulbreakdown sent me to a sanatorium for more than a year; I went back to my work-only to be hospitalized again. Robust outdoor life seemed to promise me some relief. One of my favorite doctors, a charming cynical chap with a little brown beard, had a brother, and this brother was about to lead an expedition into arctic Canada. I was attached to it as a “recorder of psychic reactions.” With two young botanists and an old carpenter I shared now and then (never very successfully) the favors of one of our nutritionists, a Dr. Anita Johnson — who was soon flownback,Iamgladtosay.Ihadlittlenotionof what object the expedition was pursuing. Judging by the number of meteorologists upon it, we may have been tracking to its lair (somewhere on Prince of Wales’ Island, I understand) the wandering and wobbly north magnetic pole. One group, jointly with the Canadians, established a weather station on Pierre Point in Melville Sound. Another group, equally misguided, collected plankton. A third studied tuberculosis in the tundra. Bert, a filmphotographer—aninsecurefellowwithwhomat one time I was made to partake in a good deal of menial work (he, too, had some psychic troubles) — maintained that the big men on our team, the real leaders we never saw, were mainly engaged in checking the influenceofclimaticameliorationon the coats of the arctic fox. We lived in prefabricated timber cabins amid a Pre-Cambrian world of granite. We had heaps of supplies — the Reader’s Digest, an ice cream mixer, chemical toilets, paper caps for Christmas. My health improved wonderfully in spite or because of all the fantastic blankness and boredom. Surrounded by such dejected vegetation as willow scrub and lichens; permeated, and, I suppose, cleansed by a whistling gale; seated on a boulder under a completely translucent sky (through which, however, nothing of importance showed), I felt curiously aloof from my own self. No temptations mad22 Lolita — Vladimir Nabokov dened me. Theplump,glossylittleEskimogirlswiththeirfishsmell,hideousravenhair and guinea pig faces, evoked even less desire in me than Dr. Johnson had. Nymphets do not occur in polar regions. I left my betters the task of analyzing glacial drifts, drumlins, and gremlins, and kremlins, and for a time tried to jot down what I fondly thought were “reactions” (I noticed, for instance, that dreams under the midnight sun tended to be highly colored, and this my friend the photographer confirmed).Iwasalsosupposed to quiz my various companions on a number of important matters, such as nostalgia, fear of unknown animals, food-fantasies, nocturnal emissions, hobbies, choice of radio programs, changes in outlook and so forth. Everybody got so fed up with this that I soon dropped the project completely, and only toward the end of my twenty months of cold labor (as one of the botanists jocosely put it) concocted a perfectly spurious and very racy report that the reader will findpublished in he Annals of Adult Psychophysics for ?945 or ?946, as well as in the issue of Arctic Explorations devoted to that particular expedition; which, in conclusion, was not really concerned with Victoria Island copper or anything like that, as I learned later from my genial doctor; for the nature of its real purpose was what is termed “hush-hush,” and so let me add merely that whatever it was, that purpose was admirably achieved. ThereaderwillregrettolearnthatsoonaftermyreturntocivilizationIhadanother bout with insanity (if to melancholia and a sense of insufferableoppression that cruel term must be applied). I owe my complete restoration to a discovery I made while being treated at that particular very expensive sanatorium. I discovered there was an endless source of robust enjoyment in triflingwithpsychiatrists:cunningly leading them on; never letting them see that you know all the tricks of the trade; inventing for them elaborate dreams, pure classics in style (which make them, the dream-extortionists, dream and wake up shrieking); teasing them with fake “primal scenes”; and never allowing them the slightest glimpse of one’s real sexual predicament. By bribing a nurse I won access to some filesanddiscovered,withglee,cards calling me “potentially homosexual” and “totally impotent.” Thesportwassoexcellent, its results — in my case — so ruddy that I stayed on for a whole month after I was quite well (sleeping admirably and eating like a schoolgirl). And then I added another week just for the pleasure of taking on a powerful newcomer, a displaced (and, surely, deranged) celebrity, known for his knack of making patients believe they had witnessed their own conception. 10 Upon signing out, I cast around for some place in the New England countryside or sleepy small town (elms, white church) where I could spend a studious summer subsisting on a compact boxful of notes I had accumulated and bathing in some nearby Vladimir Nabokov — Lolita 23 lake. My work had begun to interest me again — I mean my scholarly exertions; the other thing, my active participation in my uncle’s posthumous perfumes, had by then been cut down to a minimum. One of his former employees, the scion of a distinguished family, suggested I spend a few months in the residence of his impoverished cousins, a Mr. McCoo, retired, and his wife, who wanted to let their upper story where a late aunt had delicately dwelt. He said they had two little daughters, one a baby, the other a girl of twelve, and a beautiful garden, not far from a beautiful lake, and I said it sounded perfectly perfect. I exchanged letters with these people, satisfying them I was housebroken, and spent a fantastic night on the train, imagining in all possible detail the enigmatic nymphet I would coach in French and fondle in Humbertish. Nobody met me at the toy station where I alighted with my new expensive bag, and nobody answered the telephone; eventually, however, a distraught McCoo in wet clothes turned up at the only hotel of green-and-pink Ramsdale with the news that his house had just burned down — possibly, owing to the synchronous conflagrationthathadbeenragingallnightinmyveins.His family, he said, had fledtoafarmheowned,andhadtakenthecar,butafriendofhis wife’s, a grand person, Mrs. Haze of 342 Lawn Street, offeredtoaccommodateme.A lady who lived opposite Mrs. Haze’s had lent McCoo her limousine, a marvelously old-fashioned, square-topped affair,mannedbyacheerfulNegro.Now,sincetheonlyreason for my coming at all had vanished, the aforesaid arrangement seemed preposterous. All right, his house would have to be completely rebuilt, so what? Had he not insured it sufficiently?I wasangry,disappointedandbored,butbeinga politeEuropean,could not refuse to be sent offtoLawnStreetinthatfuneralcar,feelingthatotherwiseMcCoo would devise an even more elaborate means of getting rid of me. I saw him scamper away, and my chauffeurshookhisheadwithasoftchuckle.Enroute,Isworeto myself I would not dream of staying in Ramsdale under any circumstance but would flythatverydaytotheBermudasortheBahamasortheBlazes.Possibilitiesofsweetness on technicolor beaches had been trickling through my spine for some time before, and McCoo’s cousin had, in fact, sharply diverted that train of thought with his well-meaning but as it transpired now absolutely inane suggestion. Speaking of sharp turns: we almost ran over a meddlesome suburban dog (one of those who like in wait for cars) as we swerved into Lawn Street. A little further, the Haze house, a white-frame horror, appeared, looking dingy and old, more gray than white — the kind of place you know will have a rubber tube affixabletothetubfaucet in lieu of shower. I tipped the chauffeurandhopedhewouldimmediatelydriveaway so that I might double back unnoticed to my hotel and bag; but the man merely crossed to the other side of the street where an old lady was calling to him from her porch. What could I do? I pressed the bell button. A colored maid let me in — and left me standing on the mat while she rushed back to the kitchen where something was burning that ought not to burn. Thefronthallwasgracedwithdoorchimes,awhite-eyedwoodenthingamabob of commercial Mexican origin, and that banal darling of the arty middle class, 24 Lolita — Vladimir Nabokov van Gogh’s “Arlésienne.” A door ajar to the right affordedaglimpseofalivingroom, with some more Mexican trash in a corner cabinet and a striped sofa along the wall. Therewasastaircaseattheendofthehallway,andasIstoodmoppingmybrow (only now did I realize how hot it had been out-of-doors) and staring, to stare at something, at an old gray tennis ball that lay on an oak chest, there came from the upper landing the contralto voice of Mrs. Haze, who leaning over the banisters inquired melodiously, “Is that Monsieur Humbert?” A bit of cigarette ash dropped from there in addition. Presently, the lady herself — sandals, maroon slacks, yellow silk blouse, squarish face, in that order — came down the steps, her index fingerstilltapping upon her cigarette. I think I had better describe her right away, to get it over with. Thepoorladywas in her middle thirties, she had a shiny forehead, plucked eyebrows and quite simple but not unattractive features of a type that may be definedasaweaksolution of Marlene Dietrich. Patting her bronze-brown bun, she led me into the parlor and we talked for a minute about the McCoo fireandtheprivilegeoflivinginRamsdale. Her very wide-set sea-green eyes had a funny way of traveling all over you, carefully avoiding your own eyes. Her smile was but a quizzical jerk of one eyebrow; and uncoiling herself from the sofa as she talked, she kept making spasmodic dashes at three ashtrays and the near fender (where lay the brown core of an apple); whereupon she would sink back again, one leg folded under her. She was, obviously, one of those women whose polished words may reflectabookcluborbridgeclub,or any other deadly conventionality, but never her soul; women who are completely devoid of humor; women utterly indifferentathearttothedozenorsopossiblesubjects of a parlor conversation, but very particular about the rules of such conversations, through the sunny cellophane of which not very appetizing frustrations can be readily distinguished. I was perfectly aware that if by any wild chance I became her lodger, she would methodically proceed to do in regard to me what taking a lodger probably meant to her all along, and I would again be enmeshed in one of those tedious affairsIknewsowell. But there was no question of my settling there. I could not be happy in that type of household with bedraggled magazines on every chair and a kind of horrible hybridization between the comedy of so-called “functional modern furniture” and the tragedy of decrepit rockers and rickety lamp tables with dead lamps. I was led upstairs, and to the left — into “my” room. I inspected it through the mist of my utter rejection of it; but I did discern above “my” bed Rene Prinet’s “Kreutzer Sonata.” And she called that servant maid’s room a “semi-studio”! Let’s get out of here at once, I firmlysaidto myself as I pretended to deliberate over the absurdly, and ominously, low price that my wistful hostess was asking for board and bed. Old-world politeness, however, obliged me to go on with the ordeal. We crossed the landing to the right side of the house (where “I and Lo have our rooms” — Lo being presumably the maid), and the lodger-lover could hardly conceal a shudder when he, a very fastidious male, was granted a preview of the only bathroom, a tiny oblong Vladimir Nabokov — Lolita 25 between the landing and “Lo’s” room, with limp wet things overhanging the dubious tub (the question mark of a hair inside); and there were the expected coils of the rubber snake, and its complement — a pinkish cozy, coyly covering the toilet lid. “I see you are not too favorably impressed,” said the lady letting her hand rest for a moment upon my sleeve: she combined a cool forwardness — the overflowofwhat I think is called “poise” — with a shyness and sadness that caused her detached way of selecting her words to seem as unnatural as the intonation of a professor of “speech.” “Thisisnotaneathousehold,Iconfess,”thedoomedearcontinued,“butI assure you [she looked at my lips], you will be very comfortable, very comfortable, indeed. Let me show you the garden” (the last more brightly, with a kind of winsome toss of the voice). Reluctantly I followed her downstairs again; then through the kitchen at the end of the hall, on the right side of the house — the side where also the dining room and the parlor were (under “my” room, on the left, there was nothing but a garage). In the kitchen, the Negro maid, a plump youngish woman, said, as she took her large glossy black purse from the knob of the door leading to the back porch: “I’ll go now, Mrs. Haze.” “Yes, Louise,” answered Mrs. Haze with a sigh. “I’ll settle with you Friday.” We passed on to a small pantry and entered the dining room, parallel to the parlor we had already admired. I noticed a white sock on the floor.Withadeprecatorygrunt,Mrs. Haze stooped without stopping and threw it into a closet next to the pantry. We cursorily inspected a mahogany table with a fruit vase in the middle, containing nothing but the still glistening stone of one plum. I groped for the timetable I had in my pocket and surreptitiously fisheditouttolookassoonaspossibleforatrain.I was still walking behind Mrs. Haze though the dining room when, beyond it, there came a sudden burst of greenery — “the piazza,” sang out my leader, and then, without the least warning, a blue sea-wave swelled under my heart and, from a mat in a pool of sun, half-naked, kneeling, turning about on her knees, there was my Riviera love peering at me over dark glasses. It was the same child — the same frail, honey-hued shoulders, the same silky supple bare back, the same chestnut head of hair. A polka-dotted black kerchief tied around her chest hid from my aging ape eyes, but not from the gaze of young memory, the juvenile breasts I had fondled one immortal day. And, as if I were the fairy-tale nurse of some little princess (lost, kidnaped, discovered in gypsy rags through which her nakedness smiled at the king and his hounds), I recognized the tiny dark-brown mole on her side. With awe and delight (the king crying for joy, the trumpets blaring, the nurse drunk) I saw again her lovely indrawn abdomen where my southbound mouth had brieflypaused;andthosepuerilehipsonwhichIhadkissedthecrenulated imprint left by the band of her shorts — that last mad immortal day behind the “Roches Roses.” Thetwenty-fiveyearsI hadlivedsincethen,taperedtoa palpitating point, and vanished. I finditmostdifficultto expresswithadequateforcethatflash,thatshiver,thatimpact of passionate recognition. In the course of the sun-shot moment that my 26 Lolita — Vladimir Nabokov glance slithered over the kneeling child (her eyes blinking over those stern dark spectacles — the little Herr Doktor who was to cure me of all my aches) while I passed by her in my adult disguise (a great big handsome hunk of movieland manhood), the vacuum of my soul managed to suck in every detail of her bright beauty, and these I checked against the features of my dead bride. A little later, of course, she, this nouvelle, this Lolita, my Lolita, was to eclipse completely her prototype. All I want to stress is that my discovery of her was a fatal consequence of that “princedom by the sea” in my tortured past. Everything between the two events was but a series of gropings and blunders, and false rudiments of joy. Everything they shared made one of them. I have no illusions, however. My judges will regard all this as a piece of mummery on the part of a madman with a gross liking for the fruit vert. Au fond, ça m’est bien égal. All I now is that while the Haze woman and I went down the steps into the breathless garden, my knees were like reflectionsofkneesinripplingwater,andmy lips were like sand, and — “ThatwasmyLo,”shesaid,“andthesearemylilies.” “Yes,” I said, “yes. Theyarebeautiful,beautiful,beautiful.” 11 Exhibit number two is a pocket diary bound in black imitation leather, with a golden year, ?947, en escalier, in its upper left-hand corner. I speak of this neat product of the Blank Blank Co., Blankton, Mass., as if it were really before me. Actually, it was destroyed fiveyearsgoandwhatweexaminenow(bycourtesyofaphotographicmemory) is but its brief materialization, a puny unfledgedphoenix. I remember the thing so exactly because I wrote it really twice. First I jotted down each entry in pencil (with many erasures and corrections) on the leaves of what is commercially known as a “typewriter tablet”; then, I copied it out with obvious abbreviations in my smallest, most satanic, hand in the little black book just mentioned. May 30 is a Fast Day by Proclamation in New Hampshire but not in the Carolinas. Thatdayanepidemicof“abdominalflu”(whateverthatis)forcedRamsdaletocloseits schools for the summer. ThereadermaychecktheweatherdataintheRamsdale Journal for ?947. A few days before that I moved into the Haze house, and the little diary which I now propose to reel off(muchasaspydeliversbyheartthecontentsofthe note he swallowed) covers most of June. Thursday. Very warm day. From a vantage point (bathroom window) saw Dolores taking things offaclotheslineintheapple-greenlightbehindthehouse.Strolledout. She wore a plaid shirt, blue jeans and sneakers. Every movement she made in the dappled sun plucked at the most secret and sensitive chord of my abject body. After a while she sat down next to me on the lower step of the back porch and began to pick up the pebbles between her feet — pebbles, my God, then a curled bit of milk-bottle glass resembling a snarling lip — and chuck them at a can. Ping. You can’t a secVladimir Nabokov — Lolita 27 ond time — you can’t hit it — this is agony — a second time. Ping. Marvelous skin — oh, marvelous: tender and tanned, not the least blemish. Sundaes cause acne. Theexcessof the oily substance called sebum which nourishes the hair follicles of the skin creates, when too profuse, an irritation that opens the way to infection. But nymphets do not have acne although they gorge themselves on rich food. God, what agony, that silky shimmer above her temple grading into bright brown hair. And the little bone twitching at the side of her dust-powdered ankle. “TheMcCoogirl?GinnyMcCoo?Oh, she’s a fright. And mean. And lame. Nearly died of polio.” Ping. Theglisteningtracery of down on her forearm. When she got up to take in the wash, I had a chance of adoring from afar the faded seat of her rolled-up jeans. Out of the lawn, bland Mrs. Haze, complete with camera, grew up like a fakir’s fake tree and after some heliotropic fussing — sad eyes up, glad eyes down — had the cheek of taking my picture as I sat blinking on the steps, Humbert le Bel. Friday. Saw her going somewhere with a dark girl called Rose. Why does the way she walks — a child, mind you, a mere child! — excite me so abominably? Analyze it. A faint suggestion of turned in toes. A kind of wiggly looseness below the knee prolonged to the end of each footfall. Theghostofadrag.Veryinfantile,infinitelymeretricious. Humbert Humbert is also infinitelymovedbythelittleone’sslangyspeech,by her harsh high voice. Later heard her volley crude nonsense at Rose across the fence. Twanging through me in a rising rhythm. Pause. “I must go now, kiddo.” Saturday. (Beginning perhaps amended.) I know it is madness to keep this journal but it gives me a strange thrill to do so; and only a loving wife could decipher my microscopic script. Let me state with a sob that today my L. was sun-bathing on the so-called “piazza,” but her mother and some other woman were around all the time. Of course, I might have sat there in the rocker and pretended to read. Playing safe, I kept away, for I was afraid that the horrible, insane, ridiculous and pitiful tremor that palsied me might prevent me from making my entrée with any semblance of casualness. Sunday. Heat ripple still with us; a most favonian week. ThistimeItookupastrategic position, with obese newspaper and new pipe, in the piazza rocker before L. arrived. To my intense disappointment she came with her mother, both in two-piece bathing suits, black, as new as my pipe. My darling, my sweetheart stood for a moment near me — wanted the funnies — and she smelt almost exactly like the other one, the Riviera one, but more intensely so, with rougher overtones — a torrid odor that at once set my manhood astir — but she had already yanked out of me the coveted section and retreated to her mat near her phocine mamma. Theremybeautylaydown on her stomach, showing me, showing the thousand eyes wide open in my eyed blood, her slightly raised shoulder blades, and the bloom along the incurvation of her spine, and the swellings of her tense narrow nates clothed in black, and the seaside of her schoolgirl thighs. Silently, the seventh-grader enjoyed her green-red-blue comics. She was the loveliest nymphet green-red-blue Priap himself could think up. As I looked on, through prismatic layers of light, dry-lipped, focusing my lust and rocking slightly under my newspaper, I felt that my perception of her, if properly concen28 Lolita — Vladimir Nabokov trated upon, might be sufficienttohavemeattaina beggar’sblissimmediately;but,like some predator that prefers a moving prey to a motionless one, I planned to have this pitiful attainment coincide with the various girlish movements she made now and then as she read, such as trying to scratch the middle of her back and revealing a stippled armpit — but fat Haze suddenly spoiled everything by turning to me and asking me for a light, and starting a make-believe conversation about a fake book by some popular fraud. Monday. Delectatio morosa. I spend my doleful days in dumps and dolors. We (mother Haze, Dolores and I) were to go to Our Glass Lake this afternoon, and bathe, and bask; but a nacreous morn degenerated at noon into rain, and Lo made a scene. Themedianageofpubescenceforgirlshasbeenfoundtobethirteenyearsandnine months in New York and Chicago. Theagevariesforindividualsfromten,orearlier, to seventeen. Virginia was not quite fourteen when Harry Edgar possessed her. He gave her lessons in algebra. Je m’imagine cela. TheyspenttheirhoneymoonatPetersburg, Fla. “Monsieur Poe-poe,” as that boy in one of Monsieur Humbert Humbert’s classes in Paris called the poet-poet. I have all the characteristics which, according to writers on the sex interests of children, start the responses stirring in a little girl: clean-cut jaw, muscular hand, deep sonorous voice, broad shoulder. Moreover, I am said to resemble some crooner or actor chap on whom Lo has a crush. Tuesday. Rain. Lake of the Rains. Mamma out shopping. L., I knew, was somewhere quite near. In result of some stealthy maneuvering, I came across her in her mother’s bedroom. Prying her left eye open to get rid of a speck of something. Checked frock. Although I do love that intoxicating brown fragrance of hers, I really think she should wash her hair once in a while. For a moment, we were both in the same warm green bath of the mirror that reflectedthetopofapoplarwithusinthe sky. Held her roughly by the shoulders, then tenderly by the temples, and turned her about. “It’s right there,” she said. “I can feel it.” “Swiss peasant would use the top of her tongue.” “Lick it out?” “Yeth. Shly try?” “Sure,” she said. Gently I pressed my quivering sting along her rolling salty eyeball. “Goody-goody,” she said nictating. “It is gone.” “Now the other?” “You dope,” she began, “there is noth —” but here she noticed the pucker of my approaching lips. “Okay,” she said cooperatively, and bending toward her warm upturned russet face somber Humbert pressed his mouth to her flutteringeyelid.Shelaughed,andbrushedpastmeoutoftheroom.Myheartseemed everywhere at once. Never in my life — not even when fondling my child-love in France — never — Night. Never have I experienced such agony. I would like to describe her face, her ways — and I cannot, because my own desire for her blinds me when she is near. I am not used to being with nymphets, damn it. If I close my eyes I see but an immobilized fraction of her, a cinematographic still, a sudden smooth nether loveliness, as with one knee up under her tartan skirt she sits tying her shoe. “Dolores Haze, ne nontrez pas vos zhambes” (this is her mother who thinks she knows French). Vladimir Nabokov — Lolita 29 A poet à mes heures, I composed a madrigal to the soot-black lashes of her pale-gray vacant eyes, to the fiveasymmetricalfrecklesonherbobbednose,totheblonddown of her brown limbs; but I tore it up and cannot recall it today. Only in the tritest of terms (diary resumed) can I describe Lo’s features: I might say her hair is auburn, and her lips as red as licked red candy, the lower one prettily plump — oh, that I were a lady writer who could have her pose naked in a naked light! But instead I am lanky, big-boned, wooly-chested Humbert Humbert, with thick black eyebrows and a queer accent, and a cesspoolful of rotting monsters behind his slow boyish smile. And neither is she the fragile child of a feminine novel. What drives me insane is the twofold nature of this nymphet — of every nymphet, perhaps; this mixture in my Lolita of tender dreamy childishness and a kind of eerie vulgarity, stemming from the snub-nosed cuteness of ads and magazine pictures, from the blurry pinkness of adolescent maidservants in the Old Country (smelling of crushed daisies and sweat); and from very young harlots disguised as children in provincial brothels; and then again, all this gets mixed up with the exquisite stainless tenderness seeping through the musk and the mud, through the dirt and the death, oh God, oh God. And what is most singular is that she, this Lolita, my Lolita, has individualized the writer’s ancient lust, so that above and over everything there is — Lolita. Wednesday. “Look, make Mother take you and me to Our Glass Lake tomorrow.” Thesewerethetextualwordssaidtomebymytwelve-year-oldflameina voluptuouswhisper, as we happened to bump into one another on the front porch, I out, she in. Thereflectionoftheafternoonsun,a dazzlingwhitediamondwithinnumerableiridescent spikes quivered on the round back of a parked car. Theleafageofavoluminouselm played its mellow shadows upon the clapboard wall of the house. Two poplars shivered and shook. You could make out the formless sounds of remote traffic;a childcalling “Nancy, Nan-cy!” In the house, Lolita had put on her favorite “Little Carmen” record which I used to call “Dwarf Conductors,” making her snort with mock derision at my mock wit. Thursday. Last night we sat on the piazza, the Haze woman, Lolita and I. Warm dusk had deepened into amorous darkness. Theoldgirlhadfinishedrelatingingreatdetail the plot of a movie she and L. had seen sometime in the winter. Theboxerhadfallen extremely low when he met the good old priest (who had been a boxer himself in his robust youth and could still slug a sinner). We sat on cushions heaped on the floor,andL.wasbetweenthewomanandme(shehadsqueezedherselfin,thepet).In my turn, I launched upon a hilarious account of my arctic adventures. Themuseofinvention handed me a rifleandIshotawhitebearwhosatdownandsaid:Ah!Allthe while I was acutely aware of L.’s nearness and as I spoke I gestured in the merciful dark and took advantage of those invisible gestures of mine to touch her hand, her shoulder and a ballerina of wool and gauze which she played with and kept sticking into my lap; and finally,whenIhadcompletelyenmeshedmyglowingdarlinginthisweave of ethereal caresses, I dared stroke her bare leg along the gooseberry fuzz of her shin, and I chuckled at my own jokes, and trembled, and concealed my tremors, and 30 Lolita — Vladimir Nabokov once or twice felt with my rapid lips the warmth of her hair as I treated her to a quick nuzzling, humorous aside and caressed her plaything. She, too, fidgetedagooddealsothat finallyhermothertoldhersharplytoquititandsentthedollflyingintothedark,and I laughed and addressed myself to Haze across Lo’s legs to let my hand creep up my nymphet’s thin back and feel her skin through her boy’s shirt. But I knew it was all hopeless, and was sick with longing, and my clothes felt miserably tight, and I was almost glad when her mother’s quiet voice announced in the dark: “And now we all think that Lo should go to bed.” “I think you stink,” said Lo. “Which means there will be no picnic tomorrow,” said Haze. “Thisisafreecountry,”said Lo. When angry Lo with a Bronx cheer had gone, I stayed on from sheer inertia, while Haze smoked her tenth cigarette of the evening and complained of Lo. She had been spiteful, if you please, at the age of one, when she used to throw her toys out of her crib so that her poor mother should keep picking them up, the villainous infant! Now, at twelve, she was a regular pest, said Haze. All she wanted from life was to be one day a strutting and prancing baton twirler or a jitterbug. Her grades were poor, but she was better adjusted in her new school than in Pisky (Pisky was the Haze home town in the Middle West. TheRamsdalehousewasherlatemother-in-law’s. TheyhadmovedtoRamsdalelessthantwoyearsago).“Whywassheunhappy there?” “Oh,” said Haze, “poor me should know, I went through that when I was a kid: boys twisting one’s arm, banging into one with loads of books, pulling one’s hair, hurting one’s breasts, flippingone’sskirt.Ofcourse,moodinessisacommon concomitant of growing up, but Lo exaggerates. Sullen and evasive. Rude and defiant.StruckViola,anItalianschoolmate,intheseatwithafountainpen.Knowwhat I would like? If you, monsieur, happened to be still here in the fall, I’d ask you to help her with her homework — you seem to know everything, geography, mathematics, French.” “Oh, everything,” answered monsieur. “Thatmeans,”saidHazequickly,“you’ll be here!” I wanted to shout that I would stay on eternally if only I could hope to caress now and then my incipient pupil. But I was wary of Haze. So I just grunted and stretched my limbs nonconcomitantly (le mot juste) and presently went up to my room. Thewoman,however,wasevidentlynotpreparedtocallitaday.Iwasalready lying upon my cold bed both hands pressing to my face Lolita’s fragrant ghost when I heard my indefatigable landlady creeping stealthily up to my door to whisper through it — just to make sure, she said, I was through with the Glance and Gulp magazine I had borrowed the other day. From her room Lo yelled she had it. We are quite a lending library in this house, thunder of God. Friday. I wonder what my academic publishers would say if I were to quote in my textbook Ronsard’s “la vermeillette fente” or Remy Belleau’s “un petit mont feutré de mousse délicate, tracé sur le milieu d’un filletescarlatte”and so forth. I shall probably have another breakdown if I stay any longer in this house, under the strain of this intolerable temptation, by the side of my darling — my darling — my life and my bride. Has she already been initiated by mother nature to the Mystery of the Menarche? Bloated feelings. TheCurseoftheIrish.Fallingfromtheroof.Grandmais Vladimir Nabokov — Lolita 31 visiting. “Mr. Uterus [I quote from a girls’ magazine] starts to build a thick soft wall on the chance a possible baby may have to be bedded down there.” Thetinymadman in his padded cell. Incidentally: if I ever commit a serious murder… Mark the “if.” Theurgeshouldbesomething more than the kind of thing that happened to me with Valeria. Carefully mark that then was rather inept. If and when you wish to sizzle me to death, remember that only a spell of insanity could ever give me the simple energy to be a brute (all this amended, perhaps). Sometimes I attempt to kill in my dreams. But do you know what happens? For instance I hold a gun. For instance I aim at a bland, quietly interested enemy. Oh, I press the trigger all right, but one bullet after another feebly drops on the floorfromthesheepishmuzzle.Inthosedreams,myonlythoughtistoconceal the fiascofrommyfoe,whoisslowlygrowingannoyed. At dinner tonight the old cat said to me with a sidelong gleam of motherly mockery directed at Lo (I had just been describing, in a flippantvein,thedelightfullittletoothbrush mustache I had not quite decided to grow): “Better don’t if somebody is not to go absolutely dotty.” Instantly Lo pushed her plate of boiled fishaway,allbutknocking her milk over, and bounced out of the dining room. “Would it bore you very much,” quoth Haze, “to come with us tomorrow for a swim in Our Glass Lake if Lo apologizes for her manners?” Later, I heard a great banging of doors and other sounds coming from quaking caverns where the two rivals were having a ripping row. She had not apologized. Thelakeisout.Itmighthavebeenfun. Saturday. For some days already I had been leaving the door ajar, while I wrote in my room; but only today did the trap work. With a good deal of additional fidgeting, shuffling,scraping— todisguiseherembarrassmentatvisitingmewithouthavingbeen called — Lo came in and after pottering around, became interested in the nightmare curlicues I had penned on a sheet of paper. Oh no: they were not the outcome of a belle-lettrist’s inspired pause between two paragraphs; they were the hideous hieroglyphics (which she could not decipher) of my fatal lust. As she bent her brown curs over the desk at which I was sitting, Humbert the Hoarse put his arm around her in a miserable imitation of blood-relationship; and still studying, somewhat shortsightedly, the piece of paper she held, my innocent little visitor slowly sank to a half-sitting position upon my knee. Her adorable profile,partedlips,warmhairweresomethree inches from my bared eyetooth; and I felt the heat of her limbs through her rough tomboy clothes. All at once I knew I could kiss her throat or the wick of her mouth with perfect impunity. I knew she would let me do so, and even close her eyes as Hollywood teaches. A double vanilla with hot fudge — hardly more unusual than that. I cannot tell my learned reader (whose eyebrows, I suspect, have by now traveled all the way to the back of his bald head), I cannot tell him how the knowledge came to me; perhaps my ape-ear had unconsciously caught some slight change in the rhythm of her respiration — for now she was not really looking at my scribble, but waiting with curiosity and composure — oh, my limpid nymphet! — for the glamorous lodger 32 Lolita — Vladimir Nabokov to do what he was dying to do. A modern child, an avid reader of movie magazines, an expert in dream-slow close-ups, might not think it too strange, I guessed, if a handsome, intensely virile grown-up friend — too late. Thehousewassuddenlyvibratingwith voluble Louise’s voice telling Mrs. Haze who had just come home about a dead something she and Leslie Tomson had found in the basement, and little Lolita was not one to miss such a tale. Sunday. Changeful, bad-tempered, cheerful, awkward, graceful with the tart grace of her coltish subteens, excruciatingly desirable from head to foot (all New England for a lady-writer’s pen!), from the black read-made bow and bobby pins holding her hair in place to the little scar on the lower part of her neat calf (where a roller-skater kicked her in Pisky), a couple of inches above her rough white sock. Gone with her mother to the Hamiltons — a birthday party or something. Full-skirted gingham frock. Her little doves seem well formed already. Precocious pet! Monday. Rainy morning. “Ces matins gris si doux…” My white pajamas have a lilac design on the back. I am like one of those inflatedpalespidersyouseeinoldgardens.Sitting in the middle of a luminous web and giving little jerks to this or that strand. My web is spread all over the house as I listen from my chair where I sit like a wily wizard. Is Lo in her room? Gently I tug on the silk. She is not. Just heard the toilet paper cylinder make its staccato sound as it is turned; and no footfalls has my outflungfilamenttraced from the bathroom back to her room. Is she still brushing her teeth (the only sanitary act Lo performs with real zest)? No. Thebathroomdoorhasjustslammed,soone has to feel elsewhere about the house for the beautiful warm-colored prey. Let us have a strand of silk descend the stairs. I satisfy myself by this means that she is not in the kitchen — not banging the refrigerator door or screeching at her detested mamma (who, I suppose, is enjoying her third, cooing and subduedly mirthful, telephone conversation of the morning). Well, let us grope and hope. Ray-like, I glide in through to the parlor and findtheradiosilent(andmammastilltalkingtoMrs.ChatfieldorMrs. Hamilton, very softly, flushed,smiling,cuppingthetelephonewithherfreehand,denying by implication that she denies those amusing rumors, rumor, roomer, whispering intimately, as she never does, the clear-cut lady, in face to face talk). So my nymphet is not in the house at all! Gone! What I thought was a prismatic weave turns out to be but an old gray cobweb, the house is empty, is dead. And then comes Lolita’s soft sweet chuckle through my half-open door “Don’t tell Mother but I’ve eaten all your bacon.” Gone when I scuttle out of my room. Lolita, where are you? My breakfast tray, lovingly prepared by my landlady, leers at me toothlessly, ready to be taken in. Lola, Lolita! Tuesday. Clouds again interfered with that picnic on that unattainable lake. Is it Fate scheming? Yesterday I tried on before the mirror a new pair of bathing trunks. Wednesday. In the afternoon, Haze (common-sensical shoes, tailor-made dress), said she was driving downtown to buy a present for a friend of a friend of hers, and would I please come too because I have such a wonderful taste in textures and perfumes. “Choose your favorite seduction,” she purred. What could Humbert, being in the perfume business, do? She had me cornered between the front porch and her Vladimir Nabokov — Lolita 33 car. “Hurry up,” she said as I laboriously doubled up my large body in order to crawl in (still desperately devising a means of escape). She had started the engine, and was genteelly swearing at a backing and turning truck in front that had just brought old invalid Miss Opposite a brand new wheel chair, when my Lolita’s sharp voice came from the parlor window: “You! Where are you going? I’m coming too! Wait!” “Ignore her,” yelped Haze (killing the motor); alas for my fair driver; Lo was already pulling at the door on my side. “Thisisintolerable,”beganHaze;butLohadscrambledin,shivering with glee. “Move your bottom, you,” said Lo. “Lo!” cried Haze (sideglancing at me, hoping I would throw rude Lo out). “And behold,” said Lo (not for the firsttime), as she jerked back, as I jerked back, as the car leapt forward. “It is intolerable,” said Haze, violently getting into second, “that a child should be so ill-mannered. And so very persevering. When she knows she is unwanted. And needs a bath.” My knuckles lay against the child’s blue jeans. She was barefooted; her toenails showed remnants of cherry-red polish and there was a bit of adhesive tape across her big toe; and, God, what would I not have given to kiss then and there those delicate-boned, long-toed, monkeyish feet! Suddenly her hand slipped into mine and without our chaperon’s seeing, I held, and stroked, and squeezed that little hot paw, all the way to the store. Thewingsofthediver’sMarlenesquenoseshone,havingshedorburnedup their ration of powder, and she kept up an elegant monologue anent the local traffic,andsmiledinprofile,andpoutedinprofile,andbeatherpaintedlashesin profile,while I prayed we would never get to that store, but we did. I have nothing else to report, save, primo: that big Haze had little Haze sit behind on our way home, and secundo: that the lady decided to keep Humbert’s Choice for the backs of her own shapely ears. Thursday.We are paying with hail and gale for the tropical beginning of the month. In a volume of the Young People’s Encyclopedia, I found a map of the states that a child’s pencil had started copying out on a sheet of lightweight paper, upon the other side of which, counter to the unfinishedoutlineofFloridaandtheGulf,therewasamimeographed list of names referring, evidently, to her class at the Ramsdale school. It is a poem I know already by heart. Angel, Grace Austin, Floyd Beale, Jack Beale, Mary Buck, Daniel Byron, Marguerite Campbell, Alice Carmine, Rose Chatfield,Phyllis Clarke, Gordon Cowan, John 34 Lolita — Vladimir Nabokov Cowan, Marion Duncan, Walter Falter, Ted Fantasia, Stella Flashman, Irving Fox, George Glave, Mabel Goodale, Donald Green, Lucinda Hamilton, Mary Rose Haze, Dolores Honeck, Rosaline Knight, Kenneth McCoo, Virginia McCrystal, Vivian McFate, Aubrey Miranda, Anthony Miranda, Viola Rosato, Emil Schlenker, Lena Scott, Donald Sheridan, Agnes Sherva, Oleg Smith, Hazel Talbot, Edgar Talbot, Edwin Wain, Lull Williams, Ralph Windmuller, Louise A poem, a poem, forsooth! So strange and sweet was it to discover this “Haze, Dolores” (she!) in its special bower of names, with its bodyguard of roses — a fairy princess between her two maids of honor. I am trying to analyze the spine-thrill of delight it gives me, this name among all those others. What is it that excites me almost to tears (hot, opalescent, thick tears that poets and lovers shed)? What is it? Thetenderanonymity of this name with its formal veil (“Dolores”) and that abstract transposition of firstnameandsurname,whichislikeapairofnewpaleglovesoramask?Is“mask” the keyword? Is it because there is always delight in the semitranslucent mystery, the flowingcharshaf,throughwhichthefleshandtheeyeyoualoneareelectedto know smile in passing at you alone? Or is it because I can imagine so well the rest of the colorful classroom around my dolorous and hazy darling: Grace and her ripe pimples; Ginny and her lagging leg; Gordon, the haggard masturbator; Duncan, Vladimir Nabokov — Lolita 35 the foul-smelling clown; nail-biting Agnes; Viola, of the blackheads and the bouncing bust; pretty Rosaline; dark Mary Rose; adorable Stella, who has let strangers touch her; Ralph, who bullies and steals; Irving, for whom I am sorry. And there she is there, lost in the middle, gnawing a pencil, detested by teachers, all the boys’ eyes on her hair and neck, my Lolita. Friday. I long for some terrificdisaster.Earthquake.Spectacularexplosion.Hermother is messily but instantly and permanently eliminated, along with everybody else for miles around. Lolita whimpers in my arms. A free man, I enjoy her among the ruins. Her surprise, my explanations, demonstrations, ullulations. Idle and idiotic fancies! A brave Humbert would have played with her most disgustingly (yesterday, for instance, when she was again in my room to show me her drawings, school-artware); he might have bribed her — and got away with it. A simpler and more practical fellow would have soberly stuck to various commercial substitutes — if you know where to go, I don’t. Despite my many looks, I am horribly timid. My romantic soul gets all clammy and shivery at the thought of running into some awful indecent unpleasantness. Thoseribaldseamonsters.“Mais allez-y, allez-y!” Annabel skipping on one foot to get into her shorts, I seasick with rage, trying to screen her. Same date, later, quite late. I have turned on the light to take down a dream. It had an evident antecedent. Haze at dinner had benevolently proclaimed that since the weather bureau promised a sunny weekend we would go to the lake Sunday after church. As I lay in bed, erotically musing before trying to go to sleep, I thought of a final scheme how to profitbythepicnictocome.IwasawarethatmotherHazehatedmy darling for her being sweet on me. So I planned my lake day with a view to satisfying the mother. To her alone would I talk; but at some appropriate moment I would say I had left my wrist watch or my sunglasses in that glade yonder — and plunge with my nymphet into the wood. Reality at this juncture withdrew, and the Quest for the Glasses turned into a quiet little orgy with a singularly knowing, cheerful, corrupt and compliant Lolita behaving as reason knew she could not possibly behave. At 3 a.m. I swallowed a sleeping pill, and presently, a dream that was not a sequel but a parody revealed to me, with a kind of meaningful clarity, the lake I had never yet visited: it was glazed over with a sheet of emerald ice, and a pockmarked Eskimo was trying in vain to break it with a pickax, although imported mimosas and oleanders floweredonitsgravellybanks.IamsureDr.BlancheSchwarzmannwouldhavepaidme a sack of schillings for adding such a libidream to her files.Unfortunately,therestof it was frankly eclectic. Big Haze and little Haze rode on horseback around the lake, and I rode too, dutifully bobbing up and down, bowlegs astraddle although there was no horse between them, only elastic air — one of those little omissions due to the absentmindedness of the dream agent. Saturday. My heart is still thumping. I still squirm and emit low moans of remembered embarrassment. Dorsal view. Glimpse of shiny skin between T-shirt and white gym shorts. Bending, over a window sill, in the act of tearing offleavesfromapoplaroutsidewhile 36 Lolita — Vladimir Nabokov engrossed in torrential talk with a newspaper boy below (Kenneth Knight, I suspect) who had just propelled the Ramsdale Journal with a very precise thud onto the porch. I began creeping up to her — “crippling” up to her as pantomimists say. My arms and legs were convex surfaces between which — rather than upon which — I slowly progressed by some neutral means of locomotion: Humbert the Wounded Spider. I must have taken hours to reach her: I seemed to see her through the wrong end of a telescope, and toward her taut little rear I moved like some paralytic, on soft distorted limbs, in terrible concentration. At last I was right behind her when I had the unfortunate idea of blustering a trifle-shakingherbythescruffoftheneckandthatsortofthing to cover my real manège, and she said in a shrill brief whine: “Cut it out!” — most coarsely, the little wench, and with a ghastly grin Humbert the Humble beat a gloomy retreat while she went on wisecracking streetward. But now listen to what happened next. After lunch I was reclining in a low chair trying to read. Suddenly two deft little hands were over my eyes: she had crept up from behind as if re-enacting, in a ballet sequence, my morning maneuver. Her fingerswere a luminous crimson as they tried to blot out the sun, and she uttered hiccups of laughter and jerked this way and that as I stretched my arm sideways and backwards without otherwise changing my recumbent position. My hand swept over her agile giggling legs, and the book like a sleigh left my lap, and Mrs. Haze strolled up and said indulgently: “Just slap her hard if she interferes with your scholarly meditations. How I love this garden [no exclamation mark in her tone]. Isn’t it divine in the sun [no question mark either].” And with a sign of feigned content, the obnoxious lady sank down on the grass and looked up at the sky as she leaned back on her splayed-out hands, and presently an old gray tennis ball bounced over her, and Lo’s voice came from the house haughtily: “Pardonnez, Mother. I was not aiming at you.” Of course not, my hot downy darling. 12 Thisprovedtobethelastoftwentyentriesorso.Itwillbeseemfromthemthatforall the devil’s inventiveness, the scheme remained daily the same. First he would tempt me — and then thwart me, leaving me with a dull pain in the very root of my being. I knew exactly what I wanted to do, and how to do it, without impinging on a child’s chastity; after all, I had had some experience in my life of pederosis; had visually possessed dappled nymphets in parks; had wedged my wary and bestial way into the hottest, most crowded corner of a city bus full of straphanging school children. But for almost three weeks I had been interrupted in all my pathetic machinations. TheagentoftheseinterruptionswasusuallytheHazewoman(who, as the reader will mark, was more afraid of Lo’s deriving some pleasure from me than of my enjoying Lo). ThepassionIhaddevelopedforthatnymphet—forthe firstnymphetinmylifethatcouldbereachedatlastbymyawkward,achVladimir Nabokov — Lolita 37 ing, timid claws — would have certainly landed me again in a sanatorium, had not the devil realized that I was to be granted some relief if he wanted to have me as a plaything for some time longer. ThereaderhasalsomarkedthecuriousMirageoftheLake.Itwouldhavebeenlogical on the part of Aubrey McFate (as I would like to dub that devil of mine) to arrange a small treat for me on the promised beach, in the presumed forest. Actually, the promise Mrs. Haze had made was a fraudulent one: she had not told me that Mary Rose Hamilton (a dark little beauty in her own right) was to come too, and that the two nymphets would be whispering apart, and playing apart, and having a good time all by themselves, while Mrs. Haze and her handsome lodger conversed sedately in the seminude, far from prying eyes. Incidentally, eyes did pry and tongues did wag. How queer life is! We hasten to alienate the very fates we intended to woo. Before my actual arrival, my landlady had planned to have an old spinster, a Miss Phalen, whose mother had been cook in Mrs. Haze’s family, come to stay in the house with Lolita and me, while Mrs. Haze, a career girl at heart, sought some suitable job in the nearest city. Mrs. Haze had seen the whole situation very clearly: the bespectacled, round-backed Herr Humbert coming with his Central-European trunks to gather dust in his corner behind a heap of old books; the unloved ugly little daughter firmlysupervised by Miss Phalen who had already once had my Lo under her buzzard wing (Lo recalled that ?944 summer with an indignant shudder); and Mrs. Haze herself engaged as a receptionist in a great elegant city. But a not too complicated event interfered with that program. Miss Phalen broke her hip in Savannah, Ga., on the very day I arrived in Ramsdale. 13 TheSundayaftertheSaturdayalreadydescribedprovedtobeasbrightastheweatherman had predicted. When putting the breakfast things back on the chair outside my room for my good landlady to remove at her convenience, I gleaned the following situation by listening from the landing across which I had softly crept to the banisters in my old bedroom slippers — the only old things about me. Therehadbeenanotherrow.Mrs.Hamiltonhadtelephonedthatherdaughter“was running a temperature.” Mrs. Haze informed her daughter that the picnic would have to be postponed. Hot little Haze informed big cold Haze that, if so, she would not go with her to church. Mother said very well and left. I had come out on the landing straight after shaving, soapy-earlobed, still in my white pajamas with the cornflowerblue(notthelilac)designontheback;Inowwipedoffthesoap,perfumedmyhairandarmpits,slippedonapurplesilkdressinggown,and, humming nervously, went down the stairs in quest of Lo. I want my learned readers to participate in the scene I am about to replay; I want them to examine its every detail and see for themselves how careful, how chaste, 38 Lolita — Vladimir Nabokov the whole wine-sweet event is if viewed with what my lawyer has called, in a private talk we have had, “impartial sympathy.” So let us get started. I have a difficultjob before me. Main character: Humbert the Hummer. Time: Sunday morning in June. Place: sunlit living room. Props: old, candy-striped davenport, magazines, phonograph, Mexican knickknacks (the late Mr. Harold E. Haze — God bless the good man — had engendered my darling at the siesta hour in a blue-washed room, on a honeymoon trip to Vera Cruz, and mementoes, among these Dolores, were all over the place). She wore that day a pretty print dress that I had seen on her once before, ample in the skirt, tight in the bodice, short-sleeved, pink, checkered with darker pink, and, to complete the color scheme, she had painted her lips and was holding in her hollowed hands a beautiful, banal, Eden-red apple. She was not shod, however, for church. And her white Sunday purse lay discarded near the phonograph. My heart beat like a drum as she sat down, cool skirt ballooning, subsiding, on the sofa next to me, and played with her glossy fruit. She tossed it up into the sun-dusted air, and caught it — it made a cupped polished plop. Humbert Humbert intercepted the apple. “Give it back,” — she pleaded, showing the marbled flushofherpalms.IproducedDelicious. She grasped it and bit into it, and my heart was like snow under thin crimson skin, and with the monkeyish nimbleness that was so typical of that American nymphet, she snatched out of my abstract grip the magazine I had opened (pity no filmhadrecordedthecuriouspattern,themonogrammiclinkageofoursimultaneousor overlapping moves). Rapidly, hardly hampered by the disfiguredapplesheheld,LoflippedviolentlythroughthepagesinsearchofsomethingshewishedHumberttosee.Found it at last. I faked interest by bringing my head so close that her hair touched my temple and her arm brushed my cheek as she wiped her lips with her wrist. Because of the burnished mist through which I peered at the picture, I was slow in reacting to it, and her bare knees rubbed and knocked impatiently against each other. Dimly there came into view: a surrealist painter relaxing, supine, on a beach, and near him, likewise supine, a plaster replica of the Venus di Milo, half-buried in sand. Picture of the Week, said the legend. I whisked the whole obscene thing away. Next moment, in a sham efforttoretrieveit,shewasalloverme.Caughtherbyherthinknobbywrist. Themagazineescapedtothefloorlikea flusteredfowl.Shetwistedherselffree,recoiled, and lay back in the right-hand corner of the davenport. Then,withperfectsimplicity, the impudent child extended her legs across my lap. By this time I was in a state of excitement bordering on insanity; but I also had the cunning of the insane. Sitting there, on the sofa, I managed to attune, by a series of stealthy movements, my masked lust to her guileless limbs. It was no easy matter to divert the little maiden’s attention while I performed the obscure adjustments necessary for the success of the trick. Talking fast, lagging behind my own breath, catching up with it, mimicking a sudden toothache to explain the breaks in my patter — and all the while keeping a maniac’s inner eye on my distant golden goal, I cautiously inVladimir Nabokov — Lolita 39 creased the magic friction that was doing away, in an illusional, if not factual, sense, with the physically irremovable, but psychologically very friable texture of the material divide (pajamas and robe) between the weight of two sunburnt legs, resting athwart my lap, and the hidden tumor of an unspeakable passion. Having, in the course of my patter, hit upon something nicely mechanical, I recited, garbling them slightly, the words of a foolish song that was then popular — O my Carmen, my little Carmen, something, something, those something nights, and the stars, and the cars, and the bars, and the barmen; I kept repeating this automatic stuffandholdingherunderits special spell (spell because of the garbling), and all the while I was mortally afraid that some act of God might interrupt me, might remove the golden load in the sensation of which all my being seemed concentrated, and this anxiety forced me to work, for the firstminuteorso,morehastilythanwasconsensualwithdeliberatelymodulated enjoyment. Thestarsthatsparkled,andthecarsthatparkled,andthebars,andthe barmen, were presently taken over by her; her voice stole and corrected the tune I had been mutilating. She was musical and apple-sweet. Her legs twitched a little as they lay across my live lap; I stroked them; there she lolled in the right-hand corner, almost asprawl, Lola the bobby-soxer, devouring her immemorial fruit, singing through its juice, losing her slipper, rubbing the heel of her slipperless foot in its sloppy anklet, against the pile of old magazines heaped on my left on the sofa — and every movement she made, every shuffleandripple,helpedmetoconcealandtoimprovethesecret system of tactile correspondence between beast and beauty — between my gagged, bursting beast and the beauty of her dimpled body in its innocent cotton frock. Under my glancing fingertipsIfelttheminutehairsbristleeversoslightlyalonghershins. I lost myself in the pungent but healthy heat which like summer haze hung about little Haze. Let her stay, let her stay… As she strained to chuck the core of her abolished apple into the fender, her young weight, her shameless innocent shanks and round bottom, shifted in my tense, tortured, surreptitiously laboring lap; and all of a sudden a mysterious change came over my senses. I entered a plane of being where nothing mattered, save the infusion of joy brewed within my body. What had begun as a delicious distention of my innermost roots became a glowing tingle which now had reached that state of absolute security, confidenceandreliancenotfoundelsewhereinconsciouslife.Withthe deep hot sweetness thus established and well on its way to the ultimate convulsion, I felt I could slow down in order to prolong the glow. Lolita had been safely solipsized. Theimpliedsunpulsatedinthesuppliedpoplars;wewerefantasticallyanddivinelyalone;I watched her, rosy, gold-dusted, beyond the veil of my controlled delight, unaware of it, alien to it, and the sun was on her lips, and her lips were apparently still forming the words of the Carmen-barmen ditty that no longer reached my consciousness. Everything was now ready. Thenervesofpleasurehadbeenlaidbare.ThecorpusclesofKrausewereentering the phase of frenzy. Theleastpressurewouldsufficeto setallparadiseloose.Ihadceased to be Humbert the Hound, the sad-eyed degenerate cur clasping the boot that would presently kick him away. I was above the tribulations of ridicule, beyond the possibilities of retribution. In my self-made seraglio, I was a radiant and robust Turk, deliber40 Lolita — Vladimir Nabokov ately, in the full consciousness of his freedom, postponing the moment of actually enjoying the youngest and frailest of his slaves. Suspended on the brink of that voluptuous abyss (a nicety of physiological equipoise comparable to certain techniques in the arts) I kept repeating the chance words after her — barmen, alarmin’, my charmin’, my carmen, ahmen, ahahamen — as one talking and laughing in his sleep while my happy hand crept up her sunny leg as far as the shadow of decency allowed. Thedaybeforeshehadcollidedwiththe heavy chest in the hall and — “Look, look!” — I gasped — “look what you’ve done, what you’ve done to yourself, ah, look”; for there was, I swear, a yellowish-violet bruise on her lovely nymphet thigh which my huge hairy hand massaged and slowly enveloped — and because of her very perfunctory underthings, there seemed to be nothing to prevent my muscular thumb from reaching the hot hollow of her groin — just as you might tickle and caress a giggling child — just that — and: “Oh, it’s nothing at all,” she cried with a sudden shrill note in her voice, and she wiggled, and squirmed, and threw her head back, and her teeth rested on her glistening underlip as she half-turned away, and my moaning mouth, gentlemen of the jury, almost reached her bare neck, while I crushed out against her left buttock the last throb of the longest ecstasy man or monster had ever known. Immediately afterward (as if we had been struggling and now my grip had eased) she rolled offthesofaandjumpedtoherfeet—toherfoot,rather—inordertoattendto the formidably loud telephone that may have been ringing for ages as far as I was concerned. Thereshestoodandblinked,cheeksaflame,hairawry,hereyespassingoverme as lightly as they did over the furniture, and as she listened or spoke (to her mother who was telling her to come to lunch with her at the Chatfileds—neitherLonorHumknew yet what busybody Haze was plotting), she kept tapping the edge of the table with the slipper she held in her hand. Blessed be the Lord, she had noticed nothing! With a handkerchief of multicolored silk, on which her listening eyes rested in passing, I wiped the sweat offmyforehead,and,immersedinaeuphoriaofrelease,rearranged my royal robes. She was still at the telephone, haggling with her mother (wanted to be fetched by car, my little Carmen) when, singing louder and louder, I swept up the stairs and set a deluge of steaming water roaring into the tub. At this point I may as well give the words of that song hit in full — to the best of my recollection at least — I don’t think I ever had it right. Here goes: O my Carmen, my little Carmen! Something, something those something nights, And the stars, and the cars, and the bars and the barmen — And, O my charmin’, our dreadful fights. And the something town where so gaily, arm in Arm, we went, and our finalrow, And the gun I killed you with, O my Carmen, ThegunIamholdingnow. (Drew his .32 automatic, I guess, and put a bullet through his moll’s eye.) Vladimir Nabokov — Lolita 41 14 I had lunch in town — had not been so hungry for years. ThehousewasstillLo-lesswhen I strolled back. I spent the afternoon musing, scheming, blissfully digesting my experience of the morning. I felt proud of myself. I had stolen the honey of a spasm without impairing the morals of a minor. Absolutely no harm done. Theconjurerhadpouredmilk,molasses, foaming champagne into a young lady’s new white purse; and lo, the purse was intact. ThushadIdelicatelyconstructedmyignoble,ardent,sinfuldream;andstillLolita was safe — and I was safe. What I had madly possessed was not she, but my own creation, another, fanciful Lolita — perhaps, more real than Lolita; overlapping, encasing her; floatingbetweenmeandher,andhavingnowill,noconsciousness—indeed, no life of her own. Thechildknewnothing.Ihaddonenothingtoher.Andnothingpreventedmefrom repeating a performance that affectedheraslittleasifshewereaphotographicimage rippling upon a screen and I a humble hunchback abusing myself in the dark. Theafternoondriftedonandon,inripesilence,andthesappytalltreesseemedtobein the know; and desire, even stronger than before, began to afflictmeagain.Lethercome soon, I prayed, addressing a loan God, and while mamma is in the kitchen, let a repetition of the davenport scene be staged, please, I adore her so horribly. No: “horribly” is the wrong word. Theelationwithwhichthevisionofnewdelights filledmewasnothorriblebutpathetic.Iqualifyitaspathetic.Pathetic—becausedespite the insatiable fireofmyvenerealappetite,Iintended,withthemostferventforce and foresight, to protect the purity of that twelve-year-old child. And now see how I was repaid for my pains. No Lolita came home — she had gone with the Chatfieldstoamovie.Thetablewaslaidwithmoreelegancethanusual:candlelight, if you please. In this mawkish aura, Mrs. Haze gently touched the silver on both sides of her plate as if touching piano keys, and smiled down on her empty plate (was on a diet), and said she hoped I liked the salad (recipe lifted from a woman’s magazine). She hoped I liked the cold cuts, too. It had been a perfect day. Mrs. Chatfieldwasalovelyperson.Phyllis,herdaughter,wasgoingtoasummercamptomorrow. For three weeks. Lolita, it was decided, would go Thursday.Insteadofwaitingtill July, as had been initially planned. And stay there after Phyllis had left. Till school began. A pretty prospect, my heart. Oh, how I was taken aback — for did it not mean I was losing my darling, just when I had secretly made her mine? To explain my grim mood, I had to use the same toothache I had already simulated in the morning. Must have been an enormous molar, with an abscess as big as a maraschino cherry. “We have,” said Haze, “an excellent dentist. Our neighbor, in fact. Dr. Quilty. Uncle or cousin, I think, of the playwright. Thinkitwillpass?Well,justasyouwish.Inthe fall I shall have him ‘brace’ her, as my mother used to say. It may curb Lo a little. I am afraid she has been bothering you frightfully all these days. And we are in for 42 Lolita — Vladimir Nabokov a couple of stormy ones before she goes. She has flatlyrefusedtogo,andIconfessI left her with the ChatfieldsbecauseIdreadedtofaceheralonejustyet.Themoviemay mollify her. Phyllis is a very sweet girl, and there is no earthly reason for Lo to dislike her. Really, monsieur, I am very sorry about that tooth of yours. It would be so much more reasonable to let me contact Ivor Quilty firstthingtomorrowmorningifit still hurts. And, you know, I think a summer camp is so much healthier, and — well, it is all so much more reasonable as I say than to mope on a suburban lawn and use mamma’s lipstick, and pursue shy studious gentlemen, and go into tantrums at the least provocation.” “Are you sure,” I said at last, “that she will be happy there?” (lame, lamentably lame!) “She’d better,” said Haze. “And it won’t be all play either. ThecampisrunbyShirleyHolmes — you know, the woman who wrote CampfireGirl. Camp will teach Dolores Haze to grow in many things — health, knowledge, temper. And particularly in a sense of responsibility towards other people. Shall we take these candles with us and sit for a while on the piazza, or do you want to go to bed and nurse that tooth?” Nurse that tooth. 15 Next day they drove downtown to buy things needed for the camp: any wearable purchase worked wonders with Lo. She seemed her usual sarcastic self at dinner. Immediately afterwards, she went up to her room to plunge into the comic books acquired for rainy days at Camp Q (they were so thoroughly sampled by Thursdaythatshe left them behind). I too retired to my lair, and wrote letters. My plan now was to leave for the seaside and then, when school began, resume my existence in the Haze household; for I knew already that I could not live without the child. On Tuesday they went shopping again, and I was asked to answer the phone if the camp mistress rang up during their absence. She did; and a month or so later we had occasion to recall our pleasant chat. ThatTuesday,Lohadherdinnerinherroom.Shehadbeencrying after a routine row with her mother and, as had happened on former occasions, had not wished me to see her swollen eyes: she had one of those tender complexions that after a good cry get all blurred and inflamed,andmorbidlyalluring.Iregrettedkeenly her mistake about my private aesthetics, for I simply love that tinge of Botticellian pink, that raw rose about the lips, those wet, matted eyelashes; and, naturally, her bashful whim deprived me of many opportunities of specious consolation. Therewas, however, more to it than I thought. As we sat in the darkness of the verandah (a rude wind had put out her red candles), Haze, with a dreary laugh, said she had told Lo that her beloved Humbert thoroughly approved of the whole camp idea “and now,” added Haze, “the child throws a fit;pretext:youandIwanttogetridofher;actual reason: I told her we would exchange tomorrow for plainer stuffsomemuch Vladimir Nabokov — Lolita 43 too cute night things that she bullied me into buying for her. You see, she sees herself as a starlet; I see her as a sturdy, healthy, but decidedly homely kid. This,Iguess,isatthe root of our troubles.” On Wednesday I managed to waylay Lo for a few seconds: she was on the landing, in sweatshirt and green-stained white shorts, rummaging in a trunk. I said something meant to be friendly and funny but she only emitted a snort without looking at me. Desperate, dying Humbert patted her clumsily on her coccyx, and she struck him, quite painfully, with one of the late Mr. Haze’s shoetrees. “Doublecrosser,” she said as I crawled downstairs rubbing my arm with a great show of rue. She did not condescend to have dinner with Hum and mum: washed her hair and went to bed with her ridiculous books. And on ThursdayquietMrs.HazedrovehertoCampQ. As greater authors than I have put it: “Let readers imagine” etc. On second thought, I may as well give those imaginations a kick in the pants. I knew I had fallen in love with Lolita forever; but I also knew she would not be forever Lolita. She would be thirteen on January ?. In two years or so she would cease being a nymphet and would turn into a “young girl,” and then, into a “college girl” — that horror of horrors. Theword“forever”referredonlytomyownpassion,totheeternalLolitaasreflectedin my blood. TheLolitawhoseiliaccrestshadnotyetflared,theLolitathattodayI could touch and smell and hear and see, the Lolita of the strident voice and rich brown hair — of the bangs and the swirls and the sides and the curls at the back, and the sticky hot neck, and the vulgar vocabulary — “revolting,” “super,” “luscious,” “goon,” “drip” — that Lolita, my Lolita, poor Catullus would lose forever. So how could I afford not to see her for two months of summer insomnias? Two whole months out of the two years of her remaining nymphage! Should I disguise myself as a somber old-fashioned girl, gawky Mlle Humbert, and put up my tent on the outskirts of Camp Q, in the hope that its russet nymphets would clamor: “Let us adopt that deep-voiced D.P.,” and drag the said, shyly smiling Berthe au Grand Pied to their rustic hearth. Berthe will sleep with Dolores Haze! Idle dry dreams. Two months of beauty, two months of tenderness, would be squandered forever, and I could do nothing about it, but nothing, mais rien. One drop of rare honey, however, that Thursdaydidholdinitsacorncup.Hazewas to drive her to the camp in the early morning. Upon sundry sounds of departure reaching me, I rolled out of bed and leaned out of the window. Under the poplars, the car was already athrob. On the sidewalk, Louise stood shading her eyes with her hand, as if the little traveler were already riding into the low morning sun. Thegesture proved to be premature. “Hurry up!” shouted Haze. My Lolita, who was half in and about to slam the car door, wind down the glass, wave to Louise and the poplars (whom and which she was never to see again), interrupted the motion of fate: she looked up — and dashed back into the house (Haze furiously calling after her). A moment later I heard my sweetheart running up the stairs. My heart expanded with such force that it almost blotted me out. I hitched up the pants of my pajamas, flungthedooropen:andsimultaneouslyLolitaarrived,inherSundayfrock,stamp44 Lolita — Vladimir Nabokov ing, panting, and then she was in my arms, her innocent mouth melting under the ferocious pressure of dark male jaws, my palpitating darling! ThenextinstantIhearther — alive, unraped — clatter downstairs. Themotionoffatewasresumed.Theblondleg was pulled in, the car door was slammed — was re-slammed — and driver Haze at the violent wheel, rubber-red lips writhing in angry, inaudible speech, swung my darling away, while unnoticed by them or Louise, old Miss Opposite, an invalid, feebly but rhythmically waved from her vined veranda. 16 Thehollowofmyhandwasstillivory-fullofLolita—fullofthefeelofherpre-adolescently incurved back, that ivory-smooth, sliding sensation of her skin through the thin frock that I had worked up and down while I held her. I marched into her tumbled room, threw open the door of the closet, and plunged into a heap of crumpled things that had touched her. Therewasparticularlyonepinktexture,sleazy,torn,with a faintly acrid odor in the seam. I wrapped in it Humbert’s huge engorged heart. A poignant chaos was welling within me — but I had to drop those things and hurriedly regain my composure, as I became aware of the maid’s velvety voice calling me softly from the stairs. She had a message for me, she said; and, topping my automatic thanks with a kindly “you’re welcome,” good Louise left an unstamped, curiously clean-looking letter in my shaking hand. Thisisaconfession:Iloveyou[sotheletterbegan;andforadistortedmomentImistook its hysterical scrawl for a schoolgirl’s scribble]. Last Sunday in church — bad you, who refused to come to see our beautiful new windows! — only last Sunday, my dear one, when I asked the Lord what to do about it, I was told to act as I am acting now. You see, there is no alternative. I have loved you from the minute I saw you. I am a passionate and lonely woman and you are the love of my life. Now, my dearest, dearest, mon cher, cher monsieur, you have read this; now you know. So, will you please, at once, pack and leave. Thisisalandlady’sorder.Iamdismissinga lodger. I am kicking you out. Go! Scram! Departez! I shall be back by dinnertime, if I do eighty both ways and don’t have an accident (but what would it matter?), and I do not wish to findyouinthehouse.Please,please,leaveatonce,now, do not even read this absurd note to the end. Go. Adieu. Thesituation,chéri, is quite simple. Of course, I know with absolute certainty that I am nothing to you, nothing at all to you, nothing at all. Oh yes, you enjoy talking to me (and kidding poor me), you have grown fond of our friendly house, of the books I like, of my lovely garden, even of Lo’s noisy ways — but I am nothing to you. Right? Right. Nothing to you whatever. But if, after reading my “confession,” you decided, in your dark romantic European way, that I am attractive enough for you to take advantage of my letter and make a pass at me, then you would be a criminal — worse than Vladimir Nabokov — Lolita 45 a kidnaper who rapes a child. You see, chéri. If you decided to stay, if I found you at home (which I know I won’t — and that’s why I am able to go on like this), the fact of your remaining would only mean one thing: that you want me as much as I do you: as a lifelong mate; and that you are ready to link up your life with mine forever and ever and be a father to my little girl. Let me rave and ramble on for a teeny while more, my dearest, since I know this letter has been by now torn by you, and its pieces (illegible) in the vortex of the toilet. My dearest, mon très, très cher, what a world of love I have built up for you during this miraculous June! I know how reserved you are, how “British.” Your old-world reticence, your sense of decorum may be shocked by the boldness of an American girl! You who conceal your strongest feelings must think me a shameless little idiot for throwing open my poor bruised heart like this. In years gone by, many disappointments came my way. Mr. Haze was a splendid person, a sterling soul, but he happened to be twenty years my senior, and — well, let us not gossip about the past. My dearest, your curiosity must be well satisfiedifyouhaveignoredmyrequestandread this letter to the bitter end. Never mind. Destroy it and go. Do not forget to leave the key on the desk in your room. And some scrap of address so that I could refund the twelve dollars I owe you till the end of the month. Good-bye, dear one. Pray for me — if you ever pray. C.H. What I present here is what I remember of the letter, and what I remember of the letter I remember verbatim (including that awful French). It was at least twice longer. I have left out a lyrical passage which I more or less skipped at the time, concerning Lolita’s brother who died at 2 when she was 4, and how much I would have liked him. Let me see what else can I say? Yes. Thereisjustachancethat“thevortexof the toilet” (where the letter did go) is my own matter-of-fact contribution. She probably begged me to make a special firetoconsumeit. My firstmovementwasoneofrepulsionandretreat.Mysecondwaslikeafriend’scalm hand falling upon my shoulder and bidding me take my time. I did. I came out of my daze and found myself still in Lo’s room. A full-page ad ripped out of a slick magazine was affixedtothewallabovethebed,betweena crooner’smugandthelashesofa movie actress. It represented a dark-haired young husband with a kind of drained look in his Irish eyes. He was modeling a robe by So-and-So and holding a bridgelike tray by So-and-So, with breakfast for two. Thelegend,bytheRev.ThomasMorell, called him a “conquering hero.” Thethoroughlyconqueredlady(notshown)waspresumably propping herself up to receive her half of the tray. How her bed-fellow was to get under the bridge without some messy mishap was not clear. Lo had drawn a jocose arrow to the haggard lover’s face and had put, in block letters: H.H. And indeed, despite a differenceofafewyears,theresemblancewasstriking.Underthiswasanother picture, also a colored ad. A distinguished playwright was solemnly smoking a Drome. He always smoked Dromes. Theresemblancewasslight.Underthiswas 46 Lolita — Vladimir Nabokov Lo’s chaste bed, littered with “comics.” Theenamelhadcomeoffthebedstead,leaving black, more or less rounded, marks on the white. Having convinced myself that Louise had left, I got into Lo’s bed and reread the letter. 17 Gentlemen of the jury! I cannot swear that certain motions pertaining to the business in hand — if I may coin an expression — had not drifted across my mind before. My mind had not retained them in any logical form or in any relation to definitelyrecollected occasions; but I cannot swear — let me repeat — that I had not toyed with them (to rig up yet another expression), in my dimness of thought, in my darkness of passion. Theremayhavebeentimes—theremusthavebeentimes,ifIknowmyHumbert — when I had brought up for detached inspection the idea of marrying a mature widow (say, Charlotte Haze) with not one relative left in the wide gray world, merely in order to have my way with her child (Lo, Lola, Lolita). I am even prepared to tell my tormentors that perhaps once or twice I had cast an appraiser’s cold eye at Charlotte’s coral lips and bronze hair and dangerously low neckline, and had vaguely tried to fitherintoaplausibledaydream.ThisI confessundertorture.Imaginarytorture,perhaps, but all the more horrible. I wish I might digress and tell you more of the pavor nocturnus that would rack me at night hideously after a chance term had struck me in the random readings of my boyhood, such as peine forte et dure (what a Genius of Pain must have invented that!) or the dreadful, mysterious, insidious words “trauma,” “traumatic event,” and “transom.” But my tale is sufficientlyinconditealready. After a while I destroyed the letter and went to my room, and ruminated, and rumpled my hair, and modeled my purple robe, and moaned through clenched teeth and suddenly — Suddenly, gentlemen of the jury, I felt a Dostoevskian grin dawning (through the very grimace that twisted my lips) like a distant and terrible sun. I imagined (under conditions of new and perfect visibility) all the casual caresses her mother’s husband would be able to lavish on his Lolita. I would hold her against me three times a day, every day. All my troubles would be expelled, I would be a healthy man. “To hold thee lightly on a gentle knee and print on thy soft cheek a parent’s kiss…” Well-read Humbert! Then,withallpossiblecaution,onmentaltiptoesotospeak,IconjuredupCharlotte as a possible mate. By God, I could make myself bring her that economically halved grapefruit, that sugarless breakfast. Humbert Humbert sweating in the fiercewhitelight,andhowledat,andtrodden upon by sweating policemen, is now ready to make a further “statement” (quel mot!) as he turns his conscience inside out and rips offitsinnermostlining.Ididnotplan to marry poor Charlotte in order to eliminate her in some vulgar, gruesome and dangerous manner such as killing her by placing fivebichloride-of-mercurytabletsin her preprandial sherry or anything like that; but a delicately allied, pharmacopoeial Vladimir Nabokov — Lolita 47 thought did tinkle in my sonorous and clouded brain. Why limit myself to the modest masked caress I had tried already? Other visions of venery presented themselves to me swaying and smiling. I saw myself administering a powerful sleeping potion to both mother and daughter so as to fondle the latter though the night with perfect impunity. ThehousewasfullofCharlotte’ssnore,whileLolitahardlybreathedinhersleep, as still as a painted girl-child. “Mother, I swear Kenny never even touched me.” “You either lie, Dolores Haze, or it was an incubus.” No, I would not go that far. So Humbert the Cubus schemed and dreamed — and the red sun of desire and decision (the two things that create a live world) rose higher and higher, while upon a succession of balconies a succession of libertines, sparkling glass in hand, toasted the bliss of past and future nights. Then,figurativelyspeaking,I shatteredtheglass,and boldly imagined (for I was drunk on those visions by then and underrated the gentleness of my nature) how eventually I might blackmail — no, that it too strong a word — mauvemail big Haze into letting me consort with the little Haze by gently threatening the poor doting Big Dove with desertion if she tried to bar me from playing with my legal stepdaughter. In a word, before such an Amazing Offer,before such a vastness and variety of vistas, I was as helpless as Adam at the preview of early oriental history, miraged in his apple orchard. And now take down the following important remark: the artist in me has been given the upper hand over the gentleman. It is with a great effortofwillthatinthismemoir I have managed to tune my style to the tone of the journal that I kept when Mrs. Haze was to me but an obstacle. Thatjournalofmineisnomore;butIhaveconsidered it my artistic duty to preserve its intonations no matter how false and brutal they may seem to me now. Fortunately, my story has reached a point where I can cease insulting poor Charlotte for the sake of retrospective verisimilitude. Wishing to spare poor Charlotte two or three hours of suspense on a winding road (and avoid, perhaps, a head-on collision that would shatter our differentdreams), I made a thoughtful but abortive attempt to reach her at the camp by telephone. She had left half an hour before, and getting Lo instead, I told her — trembling and brimming with my mastery over fate — that I was going to marry her mother. I had to repeat it twice because something was preventing her from giving me her attention. “Gee, that’s swell,” she said laughing. “When is the wedding? Hold on a sec, the pup — Thatputherehasgotholdofmysock.Listen—”andsheaddedsheguessed she was going to have loads of fun… and I realized as I hung up that a couple of hours at that camp had been sufficienttoblotoutwithnewimpressionstheimageof handsome Humbert Humbert from little Lolita’s mind. But what did it matter now? I would get her back as soon as a decent amount of time after the wedding had elapsed. “Theorangeblossomwouldhavescarcelywitheredonthegrave,”asapoetmight have said. But I am no poet. I am only a very conscientious recorder. After Louise had gone, I inspected the icebox, and findingitmuchtoopuritanic,walked to town and bought the richest foods available. I also bought some good liquor and two or three kinds of vitamins. I was pretty sure that with the aid of these 48 Lolita — Vladimir Nabokov stimulants and my natural resources, I would avert any embarrassment that my indifference might incur when called upon to display a strong and impatient flame.Againand again resourceful Humbert evoked Charlotte as seen in the raree-show of a manly imagination. She was well groomed and shapely, this I could say for her, and she was my Lolita’s big sister — this notion, perhaps, I could keep up if only I did not visualize too realistically her heavy hips, round knees, ripe bust, the coarse pink skin of her neck (“coarse” by comparison with silk and honey) and all the rest of that sorry and dull thing: a handsome woman. Thesunmadeitsusualroundofthehouseastheafternoonripenedintoevening.I had a drink. And another. And yet another. Gin and pineapple juice, my favorite mixture, always double my energy. I decided to busy myself with our unkempt lawn. Une petite attention. It was crowded with dandelions, and a cursed dog — I loathe dogs — had defiledtheflatstoneswherea sundialhadoncestood.Mostofthedandelions had changed from suns to moons. TheginandLolitaweredancinginme,andI almost fell over the folding chairs that I attempted to dislodge. Incarnadine zebras! Therearesomeeructationsthatsoundlikecheers—atleast,minedid.Anoldfenceat the back of the garden separated us from the neighbor’s garbage receptacles and lilacs; but there was nothing between the front end of our lawn (where it sloped along one side of the house) and the street. ThereforeIwasabletowatch(withthesmirkof one about to perform a good action) for the return of Charlotte: that tooth should be extracted at once. As I lurched and lunged with the hand mower, bits of grass optically twittering in the low sun, I kept an eye on that section of suburban street. It curved in from under an archway of huge shade trees, then sped towards us down, down, quite sharply, past old Miss Opposite’s ivied brick house and high-sloping lawn (much trimmer than ours) and disappeared behind our own front porch which I could not see from where I happily belched and labored. Thedandelionsperished.Areekof sap mingled with the pineapple. Two little girls, Marion and Mabel, whose comings and goings I had mechanically followed of late (but who could replace my Lolita?) went toward the avenue (from which our Lawn Street cascaded), one pushing a bicycle, the other feeding from a paper bag, both talking at the top of their sunny voices. Leslie, old Miss Opposite’s gardener and chauffeur,averyamiableandathleticNegro, grinned at me from afar and shouted, re-shouted, commented by gesture, that I was mighty energetic today. Thefooldogoftheprosperousjunkdealernextdoorranafter a blue car — not Charlotte’s. Theprettierofthetwolittlegirls(Mabel,Ithink),shorts, halter with little to halt, bright hair — a nymphet, by Pan! — ran back down the street crumpling her paper bag and was hidden from this Green Goat by the frontage of Mr. And Mrs. Humbert’s residence. A station wagon popped out of the leafy shade of the avenue, dragging some of it on its roof before the shadows snapped, and swung by at an idiotic pace, the sweatshirted driver roof — holding with his left hand and the junkman’s dog tearing alongside. Therewasasmilingpause—andthen,witha flutterinmybreast,IwitnessedthereturnoftheBlueSedan.Isawitglidedownhill and disappear behind the corner of the house. I had a glimpse of her calm pale Vladimir Nabokov — Lolita 49 profile.ItoccurredtomethatuntilshewentupstairsshewouldnotknowwhetherI had gone or not. A minute later, with an expression of great anguish on her face, she looked down at me from the window of Lo’s room. By sprinting upstairs, I managed to reach that room before she left it. 18 When the bride is a window and the groom is a widower; when the former has lived in Our Great Little Town for hardly two years, and the latter for hardly a month; when Monsieur wants to get the whole damned thing over with as quickly as possible, and Madame gives in with a tolerant smile; then, my reader, the wedding is generally a “quiet” affair.Thebridemaydispensewitha tiaraoforangeblossomssecuringherfinger-tipveil,nordoesshecarryawhiteorchidinaprayerbook.Thebride’slittledaughter might have added to the ceremonies uniting H. and H. a touch of vivid vermeil; but I knew I would not dare be too tender with cornered Lolita yet, and therefore agreed it was not worth while tearing the child away from her beloved Camp Q. My soi-disant passionate and lonely Charlotte was in everyday life matter-of-fact and gregarious. Moreover, I discovered that although she could not control her heart or her cries, she was a woman of principle. Immediately after she had become more or less my mistress (despite the stimulants, her “nervous, eager chéri” — a heroic chéri! — had some initial trouble, for which, however, he amply compensated her by a fantastic display of old-world endearments), good Charlotte interviewed me about my relations with God. I could have answered that on that score my mind was open; I said, instead — paying my tribute to a pious platitude — that I believed in a cosmic spirit. Looking down at her fingernails,shealsoaskedmehadInotinmyfamilyacertain strange strain. I countered by inquiring whether she would still want to marry me if my father’s maternal grandfather had been, say, a Turk. She said it did not matter a bit; but that, if she ever found out I did not believe in Our Christian God, she would commit suicide. She said it so solemnly that it gave me the creeps. It was then I knew she was a woman of principle. Oh, she was very genteel: she said “excuse me” whenever a slight burp interrupted her flowingspeech,calledanenvelopeandahnvelope,andwhentalkingtoherlady-friends referred to me as Mr. Humbert. I thought it would please her if I entered the community trailing some glamour after me. On the day of our wedding a little interview with me appeared in the Society Column of the Ramsdale Journal, with a photograph of Charlotte, one eyebrow up and a misprint in her name (“Hazer”). Despite this contretemps, the publicity warmed the porcelain cockles of her heart — and made my rattles shake with awful glee. By engaging in church work as well as by getting to know the better mothers of Lo’s schoolmates, Charlotte in the course of twenty months or so had managed to become if not a prominent, at least an acceptable citizen, but never before had she come under that thrilling rubrique, and it was I who put her 50 Lolita — Vladimir Nabokov there, Mr. Edgar H. Humbert (I threw in the “Edgar” just for the heck of it), “writer and explorer.” McCoo’s brother, when taking it down, asked me what I had written. Whatever I told him came out as “several books on Peacock, Rainbow and other poets.” It was also noted that Charlotte and I had known each other for several years and that I was a distant relation of her firsthusband.IhintedIhadhadanaffairwithher thirteen years ago but this was not mentioned in print. To Charlotte I said that society columns should contain a shimmer of errors. Let us go on with this curious tale. When called upon to enjoy my promotion from lodger to lover, did I experience only bitterness and distaste? No. Mr. Humbert confesses to a certain titillation of his vanity, to some faint tenderness, even to a pattern of remorse daintily running along the steel of his conspiratorial dagger. Never had I thought that the rather ridiculous, through rather handsome Mrs. Haze, with her blind faith in the wisdom of her church and book club, her mannerisms of elocution, her harsh, cold, contemptuous attitude toward an adorable, downy-armed child of twelve, could turn into such a touching, helpless creature as soon as I laid my hands upon her which happened on the threshold of Lolita’s room whither she tremulously backed repeating “no, no, please no.” Thetransformationimprovedherlooks.Hersmilethathadbeensuchacontrivedthing, thenceforth became the radiance of utter adoration — a radiance having something soft and moist about it, in which, with wonder, I recognized a resemblance to the lovely, inane, lost look that Lo had when gloating over a new kind of concoction at the soda fountain or mutely admiring my expensive, always tailor-fresh clothes. Deeply fascinated, I would watch Charlotte while she swapped parental woes with some other lady and made that national grimace of feminine resignation (eyes rolling up, mouth drooping sideways) which, in an infantile form, I had seen Lo making herself. We had highballs before turning in, and with their help, I would manage to evoke the child while caressing the mother. Thiswasthewhitestomachwithinwhichmy nymphet had been a little curved fishin?934.Thiscarefullydyedhair,sosteriletomy sense of smell and touch, acquired at certain lamplit moments in the poster bed the tinge, if not the texture, of Lolita’s curls. I kept telling myself, as I wielded my brand-new large-as-life wife, that biologically this was the nearest I could get to Lolita; that at Lolita’s age, Lotte had been as desirable a schoolgirl as her daughter was, and as Lolita’s daughter would be some day. I had my wife unearth from under a collection of shoes (Mr. Haze had a passion for them, it appears) a thirty-year-old album, so that I might see how Lotte had looked as a child; and even though the light was wrong and the dresses graceless, I was able to make out a dim firstversionofLolita’soutline, legs, cheekbones, bobbed nose. Lottelita, Lolitchen. So I tom-peeped across the hedges of years, into wan little windows. And when, by means of pitifully ardent, naïvely lascivious caresses, she of the noble nipple and massive thigh prepared me for the performance of my nightly duty, it was still a nymphet’s scent that in despair I tried to pick up, as I bayed through the undergrowth of dark decaying forests. Vladimir Nabokov — Lolita 51 I simply can’t tell you how gentle, how touching my poor wife was. At breakfast, in the depressingly bright kitchen, with its chrome glitter and Hardware and Co. Calendar and cute breakfast nook (simulating that CoffeeShoppewhereintheircollegedays Charlotte and Humbert used to coo together), she would sit, robed in red, her elbow on the plastic-topped table, her cheek propped on her fist,andstareatmewithintolerable tenderness as I consumed my ham and eggs. Humbert’s face might twitch with neuralgia, but in her eyes it vied in beauty and animation with the sun and shadows of leaves rippling on the white refrigerator. My solemn exasperation was to her the silence of love. My small income added to her even smaller one impressed her as a brilliant fortune; not because the resulting sum now sufficedformostmiddle-classneeds, but because even my money shone in her eyes with the magic of my manliness, and she saw our joint account as one of those southern boulevards at midday that have solid shade on one side and smooth sunshine on the other, all the way to the end of a prospect, where pink mountains loom. Into the fiftydaysofourcohabitationCharlottecrammedtheactivitiesofasmanyyears. Thepoorwomanbusiedherselfwithanumberofthingsshehadforegonelongbefore or had never been much interested in, as if (to prolong these Proustian intonations) by my marrying the mother of the child I loved I had enabled my wife to regain an abundance of youth by proxy. With the zest of a banal young bride, she started to “glorify the home.” Knowing as I did its every cranny by heart — since those days when from my chair I mentally mapped out Lolita’s course through the house — I had long entered into a sort of emotional relationship with it, with its very ugliness and dirt, and now I could almost feel the wretched thing cower in its reluctance to endure the bath of ecru and ocher and putt-buff-and-snuffthatCharlotteplannedtogiveit. She never got as far as that, thank God, but she did use up a tremendous amount of energy in washing window shades, waxing the slats of Venetian blinds, purchasing new shades and new blinds, returning them to the store, replacing them by others, and so on, in a constant chiaroscuro of smiles and frowns, doubts and pouts. She dabbled in cretonnes and chintzes; she changed the colors of the sofa — the sacred sofa where a bubble of paradise had once burst in slow motion within me. She rearranged the furniture — and was pleased when she found, in a household treatise, that “it is permissible to separate a pair of sofa commodes and their companion lamps.” With the authoress of Your Home Is You, she developed a hatred for little lean chairs and spindle tables. She believed that a room having a generous expanse of glass, and lots of rich wood paneling was an example of the masculine type of room, whereas the feminine type was characterized by lighter-looking windows and frailer woodwork. ThenovelsIhadfound her reading when I moved in were now replaced by illustrated catalogues and homemaking guides. From a firmlocatedat4640RooseveltBlvd.,Philadelphia,sheordered for our double bed a “damask covered 3?2 coil mattress” — although the old one seemed to me resilient and durable enough for whatever it had to support. A Midwesterner, as her late husband had also been, she had lived in coy Ramsdale, the gem of an eastern state, not long enough to know all the nice people. She knew 52 Lolita — Vladimir Nabokov slightly the jovial dentist who lived in a kind of ramshackle wooden chateau behind our lawn. She had met at a church tea the “snooty” wife of the local junk dealer who owned the “colonial” white horror at the corner of the avenue. Now and then she “visited with” old Miss Opposite; but the more patrician matrons among those she called upon, or met at lawn functions, or had telephone chats with — such dainty ladies as Mrs. Glave, Mrs. Sheridan, Mrs. McCrystal, Mrs. Knight and others, seldom seemed to call on my neglected Charlotte. Indeed, the only couple with whom she had relations of real cordiality, devoid of any arrière-pensée or practical foresight, were the Farlows who had just come back from a business trip to Chile in time to attend our wedding, with the Chatfields,McCoos,andafewothers(butnotMrs.Junkorthe even prouder Mrs. Talbot). John Farlow was a middle-aged, quiet, quietly athletic, quietly successful dealer in sporting goods, who had an officeatParkington,fortymilesaway: it was he who got me the cartridges for that Colt and showed me how to use it, during a walk in the woods one Sunday; he was also what he called with a smile a part-time lawyer and had handled some of Charlotte’s affairs.Jean,hisyoungishwife(and firstcousin),wasalong-limbedgirlinharlequinglasseswithtwoboxerdogs,twopointed breasts and a big red mouth. She painted — landscapes and portraits — and vividly do I remember praising, over cocktails, the picture she had made of a niece of hers, little Rosaline Honeck, a rosy honey in a Girl Scout uniform, beret of green worsted, belt of green webbing, charming shoulder-long curls — and John removed his pipe and said it was a pity Dolly (my Dolita) and Rosaline were so critical of each other at school, but he hoped, and we all hoped, they would get on better when they returned from their respective camps. We talked of the school. It had its drawbacks, and it had its virtues. “Of course, too many of the tradespeople here are Italians,” said John, “but on the other hand we are still spared —” “I wish,” interrupted Jean with a laugh, “Dolly and Rosaline were spending the summer together.” Suddenly I imagined Lo returning from camp — brown, warm, drowsy, drugged — and was ready to weep with passion and impatience. 19 A few words more about Mrs. Humbert while the going is good (a bad accident is to happen quite soon). I had been always aware of the possessive streak in her, but I never thought she would be so crazily jealous of anything in my life that had not been she. She showed a fierceinsatiablecuriosityformypast.Shedesiredmetoresuscitate all my loves so that she might make me insult them, and trample upon them, and revoke them apostately and totally, thus destroying my past. She made me tell her about my marriage to Valeria, who was of course a scream; but I also had to invent, or to pad atrociously, a long series of mistresses for Charlotte’s morbid delectation. To keep her happy, I had to present her with an illustrated catalogue of them, all nicely differentiated,accordingtotherulesofthoseAmericanadswhereschoolVladimir Nabokov — Lolita 53 children are pictured in a subtle ratio of races, with one — only one, but as cute as they make them — chocolate-colored round-eyed little lad, almost in the very middle of the front row. So I presented my women, and had them smile and sway — the languorous blond, the fierybrunette,thesensualcopperhead—asifonparadeina bordello. ThemorepopularandplatitudinousImadethem,themoreMrs.Humbert was pleased with the show. Never in my life had I confessed so much or received so many confessions. Thesincerity and artlessness with which she discussed what she called her “love-life,” from firstneckingtoconnubialcatch-as-catch-can,were,ethically,instrikingcontrastwithmy glib compositions, but technically the two sets were congeneric since both were affectedbythesamestuff(soapoperas,psychoanalysisandcheapnovelettes)uponwhich I drew for my characters and she for her mode of expression. I was considerably amused by certain remarkable sexual habits that the good Harold Haze had had according to Charlotte who thought my mirth improper; but otherwise her autobiography was as devoid of interests as her autopsy would have been. I never saw a healthier woman than she, despite thinning diets. Of my Lolita she seldom spoke — more seldom, in fact, than she did of the blurred, blond male baby whose photograph to the exclusion of all others adorned our bleak bedroom. In once of her tasteless reveries, she predicted that the dead infant’s soul would return to earth in the form of the child she would bear in her present wedlock. And although I felt no special urge to supply the Humbert line with a replica of Harold’s production (Lolita, with an incestuous thrill, I had grown to regard as my child), it occurred to me that a prolonged confinement,withaniceCesareanoperation and other complications in a safe maternity ward sometime next spring, would give me a chance to be alone with my Lolita for weeks, perhaps — and gorge the limp nymphet with sleeping pills. Oh, she simply hated her daughter! What I thought especially vicious was that she had gone out of her way to answer with great diligence the questionnaires in a fool’s book she had (A guide to Your Child’s Development), published in Chicago. Therigmarole went year by year, and Mom was supposed to filloutakindofinventoryateachof her child’s birthdays. On Lo’s twelfth, January ?, ?947, Charlotte Haze, née Becker, had underlined the following epithets, ten out of forty, under “Your Child’s Personality”: aggressive, boisterous, critical, distrustful, impatient, irritable, inquisitive, listless, negativistic (underlined twice) and obstinate. She had ignored the thirty remaining adjectives, among which were cheerful, co-operative, energetic, and so forth. It was really maddening. With a brutality that otherwise never appeared in my loving wife’s mild nature, she attacked and routed such of Lo’s little belongings that had wandered to various parts of the house to freeze there like so many hypnotized bunnies. Little did the good lady dream that one morning when an upset stomach (the result of my trying to improve on her sauces) had prevented me from accompanying her to church, I deceived her with one of Lolita’s anklets. And then, her attitude toward my saporous darling’s letters! 54 Lolita — Vladimir Nabokov Dear Mummy and Hummy, Hope you are fine.Thankyouverymuchforthecandy.I [crossedoutandre-writtenagain] I lost my new sweater in the woods. It has been cold here for the last few days. I’m having a time. Love. Dolly “Thedumbchild,”saidMrs.Humbert,“hasleftoutawordbefore‘time.’Thatsweaterwas all-wool, and I wish you would not send her candy without consulting me.” 20 Therewasawoodlake(HourglassLake—notasIhadthoughtitwasspelled)afewmiles from Ramsdale, and there was one week of great heat at the end of July when we drove there daily. I am now obliged to describe in some tedious detail our last swim there together, one tropical Tuesday morning. We had left the car in a parking area not far from the road and were making our way down a path cut through the pine forest to the lake, when Charlotte remarked that Jean Farlow, in quest of rare light effects(Jeanbelongedtotheoldschoolofpainting), had seen Leslie taking a dip “in the ebony” (as John had quipped) at fiveo’clock in the morning last Sunday. “Thewater,”Isaid,“musthavebeenquitecold.” “Thatisnotthepoint,”saidthelogicaldoomeddear.“Heissubnormal,yousee.And,” she continued (in that carefully phrased way of hers that was beginning to tell on my health), “I have a very definitefeelingourLouiseisinlovewiththatmoron.” Feeling. “We feel Dolly is not doing as well” etc. (from an old school report). TheHumbertswalkedon,sandaledandrobed. “Do you know, Hum: I have one most ambitious dream,” pronounced Lady Hum, lowering her head — shy of that dream — and communing with the tawny ground. “I would love to get hold of a real trained servant maid like that German girl the Talbots spoke of; and have her live in the house.” “No room,” I said. “Come,” she said with her quizzical smile, “surely, chéri, you underestimate the possibilities of the Humbert home. We would put her in Lo’s room. I intended to make a guestroom of that hole anyway. It’s the coldest and meanest in the whole house.” “What are you talking about?” I asked, the skin of my cheekbones tensing up (this I take the trouble to note only because my daughter’s skin did the same when she felt that way: disbelief, disgust, irritation). “Are you bothered by Romantic Associations?” queried my wife — in allusion to her firstsurrender. “Hell no,” said I. “I just wonder where will you put your daughter when you get your guest or your maid.” Vladimir Nabokov — Lolita 55 “Ah,” said Mrs. Humbert, dreaming, smiling, drawing out the “Ah” simultaneously with the raise of one eyebrow and a soft exhalation of breath. “Little Lo, I’m afraid, does not enter the picture at all, at all. Little Lo goes straight from camp to a good boarding school with strict discipline and some sound religious training. And then — Beardsley College. I have it all mapped out, you need not worry.” She went on to say that she, Mrs. Humbert, would have to overcome her habitual sloth and write to Miss Phalli’s sister who taught at St. Algebra. Thedazzlinglakeemerged. I said I had forgotten my sunglasses in the car and would catch up with her. I had always thought that wringing one’s hands was a fictionalgesture—theobscure outcome, perhaps, of some medieval ritual; but as I took to the woods, for a spell of despair and desperate meditation, this was the gesture (“look, Lord, at these chains!”) that would have come nearest to the mute expression of my mood. Had Charlotte been Valeria, I would have known how to handle the situation; and “handle” is the word I want. In the good old days, by merely twisting fat Valechka’s brittle wrist (the one she had fallen upon from a bicycle) I could make her change her mind instantly; but anything of the sort in regard to Charlotte was unthinkable. Bland American Charlotte frightened me. My lighthearted dream of controlling her through her passion for me was all wrong. I dared not do anything to spoil the image of me she had set up to adore. I had toadied to her when she was the awesome duenna of my darling, and a groveling something still persisted in my attitude toward her. TheonlyaceI held was her ignorance of my monstrous love for her Lo. She had been annoyed by Lo’s liking me; but my feelings she could not divine. To Valeria I might have said: “Look here, you fat fool, c’est moi qui décide what is good for Dolores Humbert.” To Charlotte, I could not even say (with ingratiating calm): “Excuse me, my dear, I disagree. Let us give the child one more chance. Let me be her private tutor for a year or so. You once told me yourself —” In fact, I could not say anything at all to Charlotte about the child without giving myself away. Oh, you cannot imagine (as I had never imagined) what these women of principle are! Charlotte, who did not notice the falsity of all the everyday conventions and rules of behavior, and foods, and books, and people she doted upon, would distinguish at once a false intonation in anything I might say with a view to keeping Lo near. She was like a musician who may be an odious vulgarian in ordinary life, devoid of tact and taste; but who will hear a false note in music with diabolical accuracy of judgment. To break Charlotte’s will, I would have to break her heart. If I broke her heart, her image of me would break too. If I said: “Either I have my way with Lolita, and you help me to keep the matter quiet, or we part at once,” she would have turned as pale as a woman of clouded glass and slowly replied: “All right, whatever you add or retract, this is the end.” And the end it would be. Such, then, was the mess. I remember reaching the parking area and pumping a handful of rust-tasting water, and drinking it as avidly as if it would give me magic wisdom, youth, freedom, a tiny concubine. For a while, purple-robed, heel-dangling, I sat on the edge of one of the rude tables, under the whooshing pines. In the middle distance, two little maidens in shorts and halters came out of a sun-dappled privy 56 Lolita — Vladimir Nabokov marked “Women.” Gum-chewing Mabel (or Mabel’s understudy) laboriously, absentmindedly straddled a bicycle, and Marion, shaking her hair because of the flies,settledbehind, legs wide apart; and wobbling, they slowly, absently, merged with the light and shade. Lolita! Father and daughter melting into these woods! Thenaturalsolution was to destroy Mrs. Humbert. But how? No man can bring about the perfect murder; chance, however, can do it. Therewasthe famous dispatch of a Mme Lacour in Arles, southern France, at the close of last century. An unidentifiedbeardedsix-footer,who,itwaslaterconjectured,hadbeenthe lady’s secret lover, walked up to her in a crowded street, soon after her marriage to Colonel Lacour, and mortally stabbed her in the back, three times, while the Colonel, a small bulldog of a man, hung onto the murderer’s arm. By a miraculous and beautiful coincidence, right at the moment when the operator was in the act of loosening the angry little husband’s jaws (while several onlookers were closing in upon the group), a cranky Italian in the house nearest to the scene set offbysheeraccidentsome kind of explosive he was tinkering with, and immediately the street was turned into a pandemonium of smoke, falling bricks and running people. Theexplosionhurtno one (except that it knocked out game Colonel Lacour); but the lady’s vengeful lover ran when the others ran — and lived happily ever after. Now look what happens when the operator himself plans a perfect removal. I walked down to Hourglass Lake. Thespotfromwhichweandafewother“nice”couples (the Farlows, the Chatfields)bathedwasakindofsmallcove;myCharlotte liked it because it was almost “a private beach.” Themainbathingfacilities(ordrowning facilities” as the Ramsdale Journal had had occasion to say) were in the left (eastern) part of the hourglass, and could not be seen from our covelet. To our right, the pines soon gave way to a curve of marshland which turned again into forest on the opposite side. I sat down beside my wife so noiselessly that she started. “Shall we go in?” she asked. “We shall in a minute. Let me follow a train of thought.” I thought. More than a minute passed. “All right. Come on.” “Was I on that train?” “You certainly were.” “I hope so,” said Charlotte entering the water. It soon reached the goosefleshofher thick thighs; and then, joining her outstretched hands, shutting her mouth tight, very plain-faced in her black rubber headgear, charlotte flungherselfforwardwitha great splash. Slowly we swam out into the shimmer of the lake. On the opposite bank, at least a thousand paces away (if one cold walk across water), I could make out the tiny figuresoftwomenworkinglikebeaversontheirstretch of shore. I knew exactly who they were: a retired policeman of Polish descent and the retired plumber who owned most of the timber on that side of the lake. And Vladimir Nabokov — Lolita 57 I also knew they were engaged in building, just for the dismal fun of the thing, a wharf. Theknocksthatreachedusseemedsomuchbiggerthanwhatcouldbedistinguishedof those dwarfs’ arms and tools; indeed, one suspected the director of those acrosonic effectstohavebeenatoddswiththepuppet-master,especiallysincetheheftycrackof each diminutive blow lagged behind its visual version. Theshortwhite-sandstripof“our”beach—fromwhichbynowwehadgonealittle way to reach deep water — was empty on weekday mornings. Therewasnobodyaround except those two tiny very busy figuresontheoppositeside,andadark-redprivate plane that droned overhead, and then disappeared in the blue. Thesettingwasreally perfect for a brisk bubbling murder, and here was the subtle point: the man of law and the man of water were just near enough to witness an accident and just far enough not to observe a crime. Theywerenearenoughtohearadistractedbatherthrashing about and bellowing for somebody to come and help him save his drowning wife; and they were too far to distinguish (if they happened to look too soon) that the anything but distracted swimmer was finishingtotreadhiswifeunderfoot.Iwasnot yet at that stage; I merely want to convey the ease of the act, the nicety of the setting! So there was Charlotte swimming on with dutiful awkwardness (she was a very mediocre mermaid), but not without a certain solemn pleasure (for was not her merman by her side?); and as I watched, with the stark lucidity of a future recollection (you know — trying to see things as you will remember having seen them), the glossy whiteness of her wet face so little tanned despite all her endeavors, and her pale lips, and her naked convex forehead, and the tight black cap, and the plump wet neck, I knew that all I had to do was to drop back, take a deep breath, then grab her by the ankle and rapidly dive with my captive corpse. I say corpse because surprise, panic and inexperience would cause her to inhale at once a lethal gallon of lake, while I would be able to hold on for at least a full minute, open-eyed under water. Thefatalgesturepassedlike the tail of a falling star across the blackness of the contemplated crime. It was like some dreadful silent ballet, the male dancer holding the ballerina by her foot and streaking down through watery twilight. I might come up for a mouthful of air while still holding her down, and then would dive again as many times as would be necessary, and only when the curtain came down on her for good, would I permit myself to yell for help. And when some twenty minutes later the two puppets steadily growing arrived in a rowboat, one half newly painted, poor Mrs. Humbert Humbert, the victim of a cramp or coronary occlusion, or both, would be standing on her head in the inky ooze, some thirty feet below the smiling surface of Hourglass Lake. Simple, was it not? But what d’ye know, folks — I just could not make myself do it! She swam beside me, a trustful and clumsy seal, and all the logic of passion screamed in my ear: Now is the time! And, folks, I just couldn’t! In silence I turned shoreward and gravely, dutifully, she also turned, and still hell screamed its counsel, and still I could not make myself drown the poor, slippery, big-bodied creature. Thescreamgrew more and more remote as I realized the melancholy fact that neither tomorrow, nor Friday, nor any other day or night, could I make myself put her to death. Oh, 58 Lolita — Vladimir Nabokov I could visualize myself slapping Valeria’s breasts out of alignment, or otherwise hurting her — and I could see myself, no less clearly, shooting her lover in the underbelly and making him say “akh!” and sit down. But I could not kill Charlotte — especially when things were on the whole not quite as hopeless, perhaps, as they seemed at firstwince on that miserable morning. Were I to catch her by her strong kicking foot; were I to see her amazed look, hear her awful voice; were I still to go through with the ordeal, her ghost would haunt me all my life. Perhaps if the year were ?447 instead of ?947 I might have hoodwinked my gentle nature by administering her some classical poison from a hollow agate, some tender philter of death. But in our middle-class nosy era it would not have come offthewayitusedtointhebrocadedpalacesofthepast.Nowadays you have to be a scientist if you want to be a killer. No, no, I was neither. Ladies and gentlemen of the jury, the majority of sex offendersthathankerforsomethrobbing, sweet-moaning, physical but not necessarily coital, relation with a girl-child, are innocuous, inadequate, passive, timid strangers who merely ask the community to allow them to pursue their practically harmless, so-called aberrant behavior, their little hot wet private acts of sexual deviation without the police and society cracking down upon them. We are not sex fiends!Wedonotrapeasgoodsoldiersdo.Weareunhappy, mild, dog-eyed gentlemen, sufficientlywellintegratedtocontroloururgeinthe presence of adults, but ready to give years and years of life for one chance to touch a nymphet. Emphatically, no killers are we. Poets never kill. Oh, my poor Charlotte, do not hate me in your eternal heaven among an eternal alchemy of asphalt and rubber and metal and stone — but thank God, not water, not water! Nonetheless it was a very close shave, speaking quite objectively. And now comes the point of my perfect-crime parable. We sat down on our towels in the thirsty sun. She looked around, loosened her bra, and turned over on her stomach to give her back a chance to be feasted upon. She said she loved me. She sighed deeply. She extended one arm and groped in the pocket of her robe for her cigarettes. She sat up and smoked. She examined her right shoulder. She kissed me heavily with open smoky mouth. Suddenly, down the sand bank behind us, from under the bushes and pines, a stone rolled, then another. “Thosedisgustingpryingkids,”saidCharlotte,holdingupherbigbratoherbreastand turning prone again. “I shall have to speak about that to Peter Krestovski.” From the debouchment of the trail came a rustle, a footfall, and Jean Farlow marched down with her easel and things. “You scared us,” said Charlotte. Jean said she had been up there, in a place of green concealment, spying on nature (spies are generally shot), trying to finishalakescape,butitwasnogood,shehadnotalent whatever (which was quite true) — “And have you ever tried painting, Humbert?” Charlotte, who was a little jealous of Jean, wanted to know if John was coming. He was. He was coming home for lunch today. He had dropped her on the way to Parkington and should be picking her up any time now. It was a grand morning. She always felt a traitor to Cavall and Melampus for leaving them roped on such gorgeous Vladimir Nabokov — Lolita 59 days. She sat down on the white sand between Charlotte and me. She wore shorts. Her long brown legs were about as attractive to me as those of a chestnut mare. She showed her gums when she smiled. “I almost put both of you into my lake,” she said. “I even noticed something you overlooked. You [addressing Humbert] had your wrist watch on in, yes, sir, you had.” “Waterproof,” said Charlotte softly, making a fishmouth. Jean took my wrist upon her knee and examined Charlotte’s gift, then put back Humbert’s hand on the sand, palm up. “You could see anything that way,” remarked Charlotte coquettishly. Jean sighed. “I once saw,” she said, “two children, male and female, at sunset, right here, making love. Theirshadowsweregiants.AndItoldyouaboutMr.Tomsonatdaybreak. Next time I expect to see fat old Ivor in the ivory. He is really a freak, that man. Last time he told me a completely indecent story about his nephew. It appears —” “Hullo there,” said John’s voice. 21 My habit of being silent when displeased or, more exactly, the cold and scaly quality of my displeased silence, used to frighten Valeria out of her wits. She used to whimper and wail, saying “Ce qui me rend folle, c’est que je ne sais à quoi tu penses quand tu es comme ça.” I tried being silent with Charlotte — and she just chirped on, or chucked my silence under the chin. An astonishing woman! I would retire to my former room, now a regular “studio,” mumbling I had after all a learned opus to write, and cheerfully Charlotte went on beautifying the home, warbling on the telephone and writing letters. From my window, through the lacquered shiver of poplar leaves, I could see her crossing the street and contentedly mailing her letter to Miss Phalen’s sister. Theweekofscatteredshowersandshadowswhichelapsedafterourlastvisittothe motionless sands of Hourglass Lake was one of the gloomiest I can recall. Thencame two or three dim rays of hope — before the ultimate sunburst. It occurred to me that I had a finebraininbeautifulworkingorderandthatI might as well use it. If I dared not meddle with my wife’s plans for her daughter (getting warmer and browner every day in the fair weather of hopeless distance), I could surely devise some general means to assert myself in a general way that might be later directed toward a particular occasion. One evening, Charlotte herself provided me with an opening. “I have a surprise for you,” she said looking at me with fond eyes over a spoonful of soup. “In the fall we two are going to England.” I swallowed my spoonful, wiped my lips with pink paper (Oh, the cool rich linens of Mirana Hotel!) and said: “I have also a surprise for you, my dear. We two are not going to England.” 60 Lolita — Vladimir Nabokov “Why, what’s the matter?” she said, looking — with more surprise than I had counted upon — at my hands (I was involuntarily folding and tearing and crushing and tearing again the innocent pink napkin). My smiling face set her somewhat at ease, however. “Thematterisquitesimple,”Ireplied.“Eveninthemostharmoniousofhouseholds,as ours is, not all decisions are taken by the female partner. Therearecertainthingsthat the husband is there to decide. I can well imagine the thrill that you, a healthy American gal, must experience at crossing the Atlantic on the same ocean liner with Lady Bumble — or Sam Bumble, the Frozen Meat King, or a Hollywood harlot. And I doubt not that you and I would make a pretty ad for the Traveling Agency when portrayed looking — you, frankly starry-eyed, I, controlling my envious admiration — at the Palace Sentries, or Scarlet Guards, or Beaver Eaters, or whatever they are called. But I happen to be allergic to Europe, including merry old England. As you well know, I have nothing but very sad associations with the Old and rotting World. No colored ads in your magazines will change the situation.” “My darling,” said Charlotte. “I really —” “No, wait a minute. Thepresentmatterisonlyincidental.Iamconcernedwitha general trend. When you wanted me to spend my afternoons sunbathing on the Lake instead of doing my work, I gladly gave in and became a bronzed glamour boy for your sake, instead of remaining a scholar and, well, an educator. When you lead me to bridge and bourbon with the charming Farlows, I meekly follow. No, please, wait. When you decorate your home, I do not interfere with your schemes. When you decide — when you decide all kinds of matters, I may be in complete, or in partial, let us say, disagreement — but I say nothing. I ignore the particular. I cannot ignore the general. I love being bossed by you, but every game has its rules. I am not cross. I am not cross at all. Don’t do that. But I am one half of this household, and have a small but distinct voice.” She had come to my side and had fallen on her knees and was slowly, but very vehemently, shaking her head and clawing at my trousers. She said she had never realized. She said I was her ruler and her god. She said Louise had gone, and let us make love right away. She said I must forgive her or she would die. Thislittleincidentfilledmewithconsiderableelation.I toldherquietlythatitwas a matter not of asking forgiveness, but of changing one’s ways; and I resolved to press my advantage and spend a good deal of time, aloof and moody, working at my book — or at least pretending to work. The“studiobed”inmyformerroomhadlongbeenconvertedintothesofaithadalways been at heart, and Charlotte had warned me since the very beginning of our cohabitation that gradually the room would be turned into a regular “writer’s den.” A couple of days after the British Incident, I was sitting in a new and very comfortable easy chair, with a large volume in my lap, when Charlotte rapped with her ring fingerandsaunteredin.HowdifferentwerehermovementsfromthoseofmyLolita,when she used to visit me in her dear dirty blue jeans, smelling of orchards in nymVladimir Nabokov — Lolita 61 phetland; awkward and fey, and dimly depraved, the lower buttons of her shirt unfastened. Let me tell you, however, something. Behind the brashness of little Haze, and the poise of big Haze, a trickle of shy life ran that tasted the same, that murmured the same. A great French doctor once told my father that in near relatives the faintest gastric gurgle has the same “voice.” So Charlotte sauntered in. She felt all was not well between us. I had pretended to fall asleep the night before, and the night before that, as soon as we had gone to bed, and had risen at dawn. Tenderly, she inquired if she were not “interrupting.” “Not at the moment,” I said, turning volume C of the Girls’ Encyclopedia around to examine a picture printed “bottom-edge” as printers say. Charlotte went up to a little table of imitation mahogany with a drawer. She put her hand upon it. Thelittletablewasugly,nodoubt,butithaddonenothingtoher. “I have always wanted to ask you,” she said (businesslike, not coquettish), “why is this thing locked up? Do you want it in this room? It’s so abominably uncouth.” “Leave it alone,” I said. I was Camping in Scandinavia. “Is there a key?” “Hidden.” “Oh, Hum…” “Locked up love letters.” She gave me one of those wounded — doe looks that irritated me so much, and then, not quite knowing if I was serious, or how to keep up the conversation, stood for several slow pages (Campus, Canada, Candid Camera, Candy) peering at the window pane rather than through it, drumming upon it with sharp almond-and-rose fingernails. Presently (at Canoeing or Canvasback) she strolled up to my chair and sank down, tweedily, weightily, on its arm, inundating me with the perfume my firstwifehadused.“Would his lordship like to spend the fall here?” she asked, pointing with her little finger at an autumn view in a conservative Eastern State. “Why?” (very distinctly and slowly). She shrugged. (Probably Harold used to take a vacation at that time. Open season. Conditional reflexonherpart.) “I think I know where that is,” she said, still pointing. “ThereisahotelIremember, Enchanted Hunters, quaint, isn’t it? And the food is a dream. And nobody bothers anybody.” She rubbed her cheek against my temple. Valeria soon got over that. “Is there anything special you would like for dinner, dear? John and Jean will drop in later.” I answered with a grunt. She kissed me on my underlip, and, brightly saying she would bake a cake (a tradition subsisted from my lodging days that I adored her cakes), left me to my idleness. Carefully putting down the open book where she had sat (it attempted to send forth a rotation of waves, but an inserted pencil stopped the pages), I checked the hiding place of the key: rather self-consciously it lay under the old expensive safety razor 62 Lolita — Vladimir Nabokov I had used before she bought me a much better and cheaper one. Was it the perfect hiding place — there, under the razor, in the groove of its velvet-lined case? Thecaselay in a small trunk where I kept various business papers. Could I improve upon this? Remarkable how difficultitistoconcealthings— especiallywhenone’swifekeepsmonkeying with the furniture. 22 I think it was exactly a week after our last swim that the noon mail brought a reply from the second Miss Phalen. TheladywroteshehadjustreturnedtoSt.Algebrafrom her sister’s funeral. “Euphemia had never been the same after breaking that hip.” As to the matter of Mrs. Humbert’s daughter, she wished to report that it was too late to enroll her this year; but that she, the surviving Phalen, was practically certain that if Mr. and Mrs. Humbert brought Dolores over in January, her admittance might be arranged. Next day, after lunch, I went to see “our” doctor, a friendly fellow whose perfect bedside manner and complete reliance on a few patented drugs adequately masked his ignorance of, and indifferenceto,medicalscience.ThefactthatLowouldhavetocomebackto Ramsdale was a treasure of anticipation. For this event I wanted to be fully prepared. I had in fact begun my campaign earlier, before Charlotte made that cruel decision of hers. I had to be sure when my lovely child arrived, that very night, and then night after night, until St. Algebra took her away from me, I would possess the means of putting two creatures to sleep so thoroughly that neither sound nor touch should rouse them. ThroughoutmostofJulyIhadbeenexperimentingwithvarioussleepingpowders,tryingthem out on Charlotte, a great taker of pills. ThelastdoseIhadgivenher(shethoughtitwas a tablet of mild bromides — to anoint her nerves) had knocked her out for four solid hours. I had put the radio at full blast. I had blazed in her face an olisbos-like flashlight.I had pushed her, pinched her, prodded her — and nothing had disturbed the rhythm of her calm and powerful breathing. However, when I had done such a simple thing as kiss her, she had awakened at once, as fresh and strong as an octopus (I barely escaped). Thiswouldnotdo,Ithought;hadtogetsomethingstillsafer.Atfirst,Dr.Byrondidnot seem to believe me when I said his last prescription was no match for my insomnia. He suggested I try again, and for a moment diverted my attention by showing me photographs of his family. He had a fascinating child of Dolly’s age; but I saw through his tricks and insisted he prescribe the mightiest pill extant. He suggested I play golf, but finallyagreedtogivemesomethingthat,hesaid,“wouldreallywork”;andgoingtoa cabinet, he produced a vial of violet-blue capsules banded with dark purple at one end, which, he said, had just been placed on the market and were intended not for neurotics whom a draft of water could calm if properly administered, but only for great sleepless artists who had to die for a few hours in order to live for centuries. I love to fool doctors, and though inwardly rejoicing, pocketed the pills with a skeptical shrug. IncidenVladimir Nabokov — Lolita 63 tally, I had had to be careful with him. Once, in another connection, a stupid lapse on my part made me mention my last sanatorium, and I thought I saw the tips of his ears twitch. Being not at all keen for Charlotte or anybody else to know that period of my past, I had hastily explained that I had once done some research among the insane for a novel. But no matter; the old rogue certainly had a sweet girleen. I left in great spirits. Steering my wife’s car with one finger,Icontentedlyrolledhomeward. Ramsdale had, after all, lots of charm. Thecicadaswhirred;theavenuehad been freshly watered. Smoothly, almost silkily, I turned down into our steep little street. Everything was somehow so right that day. So blue and green. I knew the sun shone because my ignition key was reflectedinthewindshield;andIknewitwasexactly half past three because the nurse who came to massage Miss Opposite every afternoon was tripping down the narrow sidewalk in her white stockings and shoes. As usual, Junk’s hysterical setter attacked me as I rolled downhill, and as usual, the local paper was lying on the porch where it had just been hurled by Kenny. ThedaybeforeIhadendedtheregimeofaloofnessIhadimposeduponmyself,and now uttered a cheerful homecoming call as I opened the door of the living room. With her cream-white nape and bronze bun to me, wearing the yellow blouse and maroon slacks she had on when I firstmether,Charlottesatatthecornerbureauwritinga letter. My hand still on the doorknob, I repeated my hearty cry. Her writing hand stopped. She sat still for a moment; then she slowly turned in her chair and rested her elbow on its curved back. Her face, disfiguredbyheremotion,wasnotaprettysightas she stared at my legs and said: “TheHazewoman,thebigbitch,theoldcat,theobnoxiousmamma,the—theoldstupid Haze is no longer your dupe. She has — she has…” My fair accuser stopped, swallowing her venom and her tears. Whatever Humbert Humbert said — or attempted to say — is inessential. She went on: “You’re a monster. You’re a detestable, abominable, criminal fraud. If you come near — I’ll scream out the window. Get back!” Again, whatever H.H. murmured may be omitted, I think. “I am leaving tonight. Thisisallyours.Onlyyou’llnever,neverseethatmiserablebrat again. Get out of this room.” Reader, I did. I went up to the ex-semi-studio. Arms akimbo, I stood for a moment quite still and self-composed, surveying from the threshold the raped little table with its open drawer, a key hanging from the lock, four other household keys on the table top. I walked across the landing into the Humberts’ bedroom, and calmly removed my diary from under her pillow into my pocket. ThenIstartedtowalkdownstairs,butstopped half-way: she was talking on the telephone which happened to be plugged just outside the door of the living room. I wanted to hear what she was saying: she canceled an order for something or other, and returned to the parlor. I rearranged my respiration and went through the hallway to the kitchen. There,IopenedabottleofScotch. She could never resist Scotch. ThenIwalkedintothediningroomandfromthere, through the half-open door, contemplated Charlotte’s broad back. 64 Lolita — Vladimir Nabokov “You are ruining my life and yours,” I said quietly. “Let us be civilized people. It is all your hallucination. You are crazy, Charlotte. Thenotesyoufoundwerefragmentsof a novel. Your name and hers were put in by mere chance. Just because they came handy. Thinkitover.Ishallbringyouadrink.” She neither answered nor turned, but went on writing in a scorching scrawl whatever she was writing. A third letter, presumably (two in stamped envelopes were already laid out on the desk). I went back to the kitchen. I set out two glasses (to St. Algebra? to Lo?) and opened the refrigerator. It roared at me viciously while I removed the ice from its heart. Rewrite. Let her read it again. She will not recall details. Change, forge. Write a fragment and show it to her or leave it lying around. Why do faucets sometimes whine so horribly? A horrible situation, really. Thelittlepillow-shapedblocksofice-pillowsforpolarteddybear,Lo—emitted rasping, crackling, tortured sounds as the warm water loosened them in their cells. I bumped down the glasses side by side. I poured in the whiskey and a dram of soda. She had tabooed my pin. Bark and bang went the icebox. Carrying the glasses, I walked through the dining room and spoke through the parlor door which was a fraction ajar, not quite space enough for my elbow. “I have made you a drink,” I said. She did not answer, the mad bitch, and I placed the glasses on the sideboard near the telephone, which had started to ring. “Leslie speaking. Leslie Tomson,” said Leslie Tomson who favored a dip at dawn. “Mrs. Humbert, sir, has been run over and you’d better come quick.” I answered, perhaps a bit testily, that my wife was safe and sound, and still holding the receiver, I pushed open the door and said: “There’sthismansayingyou’vebeenkilled,Charlotte.” But there was no Charlotte in the living room. 23 I rushed out. Thefarsideofoursteeplittlestreetpresentedapeculiarsight.Abigblack glossy Packard had climbed Miss Opposite’s sloping lawn at an angle from the sidewalk (where a tartan laprobe had dropped in a heap), and stood there, shining in the sun, its doors open like wings, its front wheels deep in evergreen shrubbery. To the anatomical right of this car, on the trim turn of the lawn-slope, an old gentleman with a white mustache, well-dressed — doublebreasted gray suit, polka-dotted bow-tie — lay supine, his long legs together, like a death-size wax figure.Ihavetoputthe impact of an instantaneous vision into a sequence of words; their physical accumulation in the page impairs the actual flash,thesharpunityofimpression:Rug-heap,car,old man-doll, Miss O.’s nurse running with a rustle, a half-empty tumbler in her hand, back to the screened porch — where the propped-up, imprisoned, decrepit lady herself may be imagined screeching, but not loud enough to drown the rhythmical yaps Vladimir Nabokov — Lolita 65 of the Junk setter walking from group to group — from a bunch of neighbors already collected on the sidewalk, near the bit of checked stuff,andbacktothecarwhichhehad finallyruntoearth,andthentoanothergrouponthelawn,consistingofLeslie,two policemen and a sturdy man with tortoise shell glasses. At this point, I should explain that the prompt appearance of the patrolmen, hardly more than a minute after the accident, was due to their having been ticketing the illegally parked cars in a cross lane two blocks down the grade; that the fellow with the glasses was Frederick Beale, Jr., driver of the Packard; that his 79-year-old father, whom the nurse had just watered on the green bank where he lay — a banked banker so to speak — was not in a dead faint, but was comfortably and methodically recovering from a mild heart attack or its possibility; and, finally,thatthelaprobeonthesidewalk(whereshehadsooftenpointed out to me with disapproval the crooked green cracks) concealed the mangled remains of Charlotte Humbert who had been knocked down and dragged several feet by the Beale car as she was hurrying across the street to drop three letters in the mailbox, at the corner of Miss Opposite’s lawn. Thesewerepickedupandhandedtomeby a pretty child in a dirty pink frock, and I got rid of them by clawing them to fragments in my trouser pocket. ThreedoctorsandtheFarlowspresentlyarrivedonthesceneandtookover.Thewidower,amanofexceptionalself-control,neitherweptnorraved.Hestaggereda bit, that he did; but he opened his mouth only to impart such information or issue such directions as were strictly necessary in connection with the identification,examination and disposal of a dead woman, the top of her head a porridge of bone, brains, bronze hair and blood. Thesunwasstillablindingredwhenhewasputtobed in Dolly’s room by his two friends, gentle John and dewy-eyed Jean; who, to be near, retired to the Humberts’ bedroom for the night; which, for all I know, they may not have spent as innocently as the solemnity of the occasion required. I have no reason to dwell, in this very special memoir, on the pre-funeral formalities that had to be attended to, or on the funeral itself, which was as quiet as the marriage had been. But a few incidents pertaining to those four or fivedaysafterCharlotte’s simple death, have to be noted. My firstnightofwidowhoodIwassodrunkthatIsleptassoundlyasthechildwho had slept in that bed. Next morning I hastened to inspect the fragments of letters in my pocket. Theyhadgottoothoroughlymixeduptobesortedintothreecompletesets. I assumed that “… and you had better finditbecauseIcannotbuy…”camefroma letter to Lo; and other fragments seemed to point to Charlotte’s intention of fleeingwith Lo to Parkington, or even back to Pisky, lest the vulture snatch her precious lamb. Other tatters and shreds (never had I thought I had such strong talons) obviously referred to an application not to St. A. but to another boarding school which was said to be so harsh and gray and gaunt in its methods (although supplying croquet under the elms) as to have earned the nickname of “Reformatory for Young Ladies.” Finally, the third epistle was obviously addressed to me. I made out such items as “…after a year of separation we may…” “…oh, my dearest, oh my…” “…worse than if it had 66 Lolita — Vladimir Nabokov been a woman you kept…” “…or, maybe, I shall die…” But on the whole my gleanings made little sense; the various fragments of those three hasty missives were as jumbled in the palms of my hands as their elements had been in poor Charlotte’s head. ThatdayJohnhadtoseeacustomer,andJeanhadtofeedherdogs,andsoIwastobe deprived temporarily of my friends’ company. ThedearpeoplewereafraidImightcommit suicide if left alone, and since no other friends were available (Miss Opposite was incommunicado, the McCoos were busy building a new house miles away, and the ChatfieldshadbeenrecentlycalledtoMainebysomefamilytroubleoftheirown), Leslie and Louise were commissioned to keep me company under the pretense of helping me to sort out and pack a multitude of orphaned things. In a moment of superb inspiration I showed the kind and credulous Farlows (we were waiting for Leslie to come for his paid tryst with Louise) a little photograph of Charlotte I had found among her affairs.Fromabouldershesmiledthroughblownhair.Ithadbeentaken in April ?934, a memorable spring. While on a business visit to the States, I had had occasion to spend several months in Pisky. We met — and had a mad love affair.I was married, alas, and she was engaged to Haze, but after I returned to Europe, we corresponded through a friend, now dead. Jean whispered she had heard some rumors and looked at the snapshot, and, still looking, handed it to John, and John removed his pipe and looked at lovely and fast Charlotte Becker, and handed it back to me. Thentheyleftforafewhours.HappyLouisewasgurglingandscoldingherswain in the basement. Hardly had the Farlows gone than a blue-chinned cleric called — and I tried to make the interview as brief as was consistent with neither hurting his feelings nor arousing his doubts. Yes, I would devote all my life to the child’s welfare. Here, incidentally, was a little cross that Charlotte Becker had given me when we were both young. I had a female cousin, a respectable spinster in New York. Therewewouldfinda good private school for Dolly. Oh, what a crafty Humbert! For the benefitofLeslieandLouisewhomight(anddid)reportittoJohnandJean I made a tremendously loud and beautifully enacted long-distance call and simulated a conversation with Shirley Holmes. When John and Jean returned, I completely took them in by telling them, in a deliberately wild and confused mutter, that Lo had gone with the intermediate group on a five-dayhikeandcouldnotbereached. “Good Lord,” said Jean, “what shall we do?” John said it was perfectly simple — he would get the Climax police to findthehikers — it would not take them an hour. In fact, he knew the country and — “Look,” he continued, “why don’ I drive there right now, and you may sleep with Jean” — (he did not really add that but Jean supported his offersopassionatelythatitmight be implied). I broke down. I pleaded with John to let things remain the way they were. I said I could not bear to have the child all around me, sobbing, clinging to me, she was so high-strung, the experience might react on her future, psychiatrists have analyzed such cases. Therewasasuddenpause. Vladimir Nabokov — Lolita 67 “Well, you are the doctor,” said John a little bluntly. “But after all I was Charlotte’s friend and adviser. One would like to know what you are going to do about the child anyway.” “John,” cried Jean, “she is his child, not Harold Haze’s. Don’t you understand? Humbert is Dolly’s real father.” “I see,” said John. “I am sorry. Yes. I see. I did not realize that. It simplifiesmatters,of course. And whatever you feel is right.” Thedistraughtfatherwentontosayhewouldgoandfetchhisdelicatedaughterimmediately after the funeral, and would do his best to give her a good time in totally differentsurroundings,perhapsatriptoNewMexicoorCalifornia—granted,of course, he lived. So artistically did I impersonate the calm of ultimate despair, the hush before some crazy outburst, that the perfect Farlows removed me to their house. Theyhada good cellar, as cellars go in this country; and that was helpful, for I feared insomnia and a ghost. Now I must explain my reasons for keeping Dolores away. Naturally, at first,whenCharlotte had just been eliminated and I re-entered the house a free father, and gulped down the two whiskey-and-sodas I had prepared, and topped them with a pint or two of my “pin,” and went to the bathroom to get away from neighbors and friends, there was but one thing in my mind and pulse — namely, the awareness that a few hours hence, warm, brown-haired, and mine, mine, mine, Lolita would be in my arms, shedding tears that I would kiss away faster than they could well. But as I stood wide-eyed and flushedbeforethemirror,JohnFarlowtenderlytappedtoinquireifIwasokay — and I immediately realized it would be madness on my part to have her in the house with all those busybodies milling around and scheming to take her away from me. Indeed, unpredictable Lo herself might — who knows? — show some foolish distrust of me, a sudden repugnance, vague fear and the like — and gone would be the magic prize at the very instant of triumph. Speaking of busybodies, I had another visitor — friend Beale, the fellow who eliminated my wife. Stodgy and solemn, looking like a kind of assistant executioner, with his bulldog jowls, small black eyes, thickly rimmed glasses and conspicuous nostrils, he was ushered in by John who then left us, closing the door upon us, with the utmost tact. Suavely saying he had twins in my stepdaughter’s class, my grotesque visitor unrolled a large diagram he had made of the accident. It was, as my stepdaughter would have put it, “a beaut,” with all kinds of impressive arrows and dotted lines in varicolored inks. Mrs. H.H.’s trajectory was illustrated at several points by a series of those little outline figures—doll-likeweecareergirlorWAC—usedinstatisticsasvisual aids. Very clearly and conclusively, this route came into contact with a boldly traced sinuous line representing two consecutive swerves — one which the Beale car made to avoid the Junk dog (dog not shown), and the second, a kind of exaggerated continuation of the first,meanttoavertthetragedy.Averyblackcrossindicatedthe spot where the trim little outline figurehadatlastcometorestonthesidewalk. 68 Lolita — Vladimir Nabokov I looked for some similar mark to denote the place on the embankment where my visitor’s huge wax father had reclined, but there was none. Thatgentleman,however,had signed the document as a witness underneath the name of Leslie Tomson, Miss Opposite and a few other people. With his hummingbird pencil deftly and delicately flyingfromonepointtoanother, Frederick demonstrated his absolute innocence and the recklessness of my wife: while he was in the act of avoiding the dog, she had slipped on the freshly watered asphalt and plunged forward whereas she should have flungherselfnotforwardbutbackward (Fred showed how by a jerk of his padded shoulder). I said it was certainly not his fault, and the inquest upheld my view. Breathing violently though jet-black tense nostrils, he shook his head and my hand; then, with an air of perfect savoir vivre and gentlemanly generosity, he offeredto pay the funeral-home expenses. He expected me to refuse his offer.Withadrunkensob of gratitude I accepted it. Thistookhimaback.Slowly,incredulously,herepeatedwhat he had said. I thanked him again, even more profusely than before. In result of that weird interview, the numbness of my soul was for a moment resolved. And no wonder! I had actually seen the agent of fate. I had palpated the very fleshoffate—anditspaddedshoulder.Abrilliantandmonstrousmutationhadsuddenly taken place, and here was the instrument. Within the intricacies of the pattern (hurrying housewife, slippery pavement, a pest of a dog, steep grade, big car, baboon at its wheel), I could dimly distinguish my own vile contribution. Had I not been such a fool — or such an intuitive genius — to preserve that journal, fluidsproducedby vindictive anger and hot shame would not have blinded Charlotte in her dash to the mailbox. But even had they blinded her, still nothing might have happened, had not precise fate, that synchronizing phantom, mixed within its alembic the car and the dog and the sun and the shade and the wet and the weak and the strong and the stone. Adieu, Marlene! Fat fate’s formal handshake (as reproduced by Beale before leaving the room) brought me out of my torpor; and I wept. Ladies and gentlemen of the jury — I wept. 24 Theelmsandthepoplarswereturningtheirruffledbacksto asuddenonslaughtof wind, and a black thunderhead loomed above Ramsdale’s white church tower when I looked around me for the last time. For unknown adventures I was leaving the livid house where I had rented a room only ten weeks before. Theshades—thrifty,practical bamboo shades — were already down. On porches or in the house their rich textures lend modern drama. Thehouseofheavenmustseemprettybareafterthat.A raindrop fell on my knuckles. I went back into the house for something or other while John was putting my bags into the car, and then a funny thing happened. I do not know if in these tragic notes I have sufficientlystressedthepeculiar“sending”efVladimir Nabokov — Lolita 69 fect that the writer’s good looks — pseudo-Celtic, attractively simian, boyishly manly — had on women of every age and environment. Of course, such announcements made in the firstpersonmaysoundridiculous.ButeveryonceinawhileIhavetoremind the reader of my appearance much as a professional novelist, who has given a character of his some mannerism or a dog, has to go on producing that dog or that mannerism every time the character crops up in the course of the book. Theremaybemore to it in the present case. My gloomy good looks should be kept in the mind’s eye if my story is to be properly understood. Pubescent Lo swooned to Humbert’s charm as she did to hiccuppy music; adult Lotte loved me with a mature, possessive passion that I now deplore and respect more than I care to say. Jean Farlow, who was thirty-one and absolutely neurotic, had also apparently developed a strong liking for me. She was handsome in a carved-Indian sort of way, with a burnt sienna complexion. Her lips were like large crimson polyps, and when she emitted her special barking laugh, she showed large dull teeth and pale gums. She was very tall, wore either slacks with sandals or billowing skirts with ballet slippers, drank any strong liquor in any amount, had had two miscarriages, wrote stories about animals, painted, as the reader knows, lakescapes, was already nursing the cancer that was to kill her at thirty-three, and was hopelessly unattractive to me. Judge then of my alarm when a few seconds before I left (she and I stood in the hallway) Jean, with her always trembling fingers,tookmebythetemples,and,tearsinherbright blue eyes, attempted, unsuccessfully, to glue herself to my lips. “Take care of yourself,” she said, “kiss your daughter for me.” A clap of thunder reverberated throughout the house, and she added: “Perhaps, somewhere, some day, at a less miserable time, we may see each other again” (Jean, whatever, wherever you are, in minus time-space or plus soul-time, forgive me all this, parenthesis included). And presently I was shaking hands with both of them in the street, the sloping street, and everything was whirling and flyingbeforetheapproachingwhitedeluge, and a truck with a mattress from Philadelphia was confidentlyrollingdowntoan empty house, and dust was running and writhing over the exact slab of stone where Charlotte, when they lifted the laprobe for me, had been revealed, curled up, her eyes intact, their black lashes still wet, matted, like yours, Lolita. 25 One might suppose that with all blocks removed and a prospect of delirious and unlimited delights before me, I would have mentally sunk back, heaving a sigh of delicious relief. Eh bine, pas du tout! Instead of basking in the beams of smiling Chance, I was obsessed by all sorts of purely ethical doubts and fears. For instance: might it not surprise people that Lo was so consistently debarred from attending festive and funeral functions in her immediate family? You remember — we had not had her at 70 Lolita — Vladimir Nabokov our wedding. Or another thing: granted it was the long hairy arm of Coincidence that had reached out to remove an innocent woman, might Coincidence not ignore in a heathen moment what its twin lamb had done and hand Lo a premature note of commiseration? True, the accident had been reported only by the Ramsdale Journal — not by the Parkington Recorder or the Climax Herald, Camp Q being in another state, and local deaths having no federal news interest; but I could not help fancying that somehow Dolly Haze had been informed already, and that at the very time I was on my way to fetch her, she was being driven to Ramsdale by friends unknown to me. Still more disquieting than all these conjectures and worries, was the fact that Humbert Humbert, a brand-new American citizen of obscure European origin, had taken no steps toward becoming the legal guardian of his dead wife’s daughter (twelve years and seven months old). Would I ever dare take those steps? I could not repress a shiver whenever I imagined my nudity hemmed in by mysterious statutes in the merciless glare of the Common Law. My scheme was a marvel of primitive art: I would whizz over to Camp Q, tell Lolita her mother was about to undergo a major operation at an invented hospital, and then keep moving with my sleepy nymphet from inn to inn while her mother got better and better and finallydied.ButasItraveledcampwardmyanxietygrew.Icouldnot bear to think I might not findLolitathere—orfind,instead,another,scared,Lolita clamoring for some family friend: not the Farlows, thank God — she hardly knew them — but might there not be other people I had not reckoned with? Finally, I decided to make the long-distance call I had simulated so well a few days before. It was raining hard when I pulled up in a muddy suburb of Parkington, just before the Fork, one prong of which bypassed the city and led to the highway which crossed the hills to Lake Climax and Camp Q. I flippedofftheignitionandforquitea minutesatinthe car bracing myself for that telephone call, and staring at the rain, at the inundated sidewalk, at a hydrant: a hideous thing, really, painted a thick silver and red, extending the red stumps of its arms to be varnished by the rain which like stylized blood dripped upon its argent chains. No wonder that stopping beside those nightmare cripples is taboo. I drove up to a gasoline station. A surprise awaited me when at last the coins had satisfactorily clanked down and a voice was allowed to answer mine. Holmes, the camp mistress, informed me that Dolly had gone Monday (this was Wednesday) on a hike in the hills with her group and was expected to return rather late today. Would I care to come tomorrow, and what was exactly — Without going into details, I said that her mother was hospitalized, that the situation was grave, that the child should not be told it was grave and that she should be ready to leave with me tomorrow afternoon. Thetwovoicespartedinanexplosionofwarmthandgoodwill, and through some freak mechanical flawallmycoinscametumblingbacktomewith a hitting-the-jackpot clatter that almost made me laugh despite the disappointment at having to postpone bliss. One wonders if this sudden discharge, this spasmodic refund, was not correlated somehow, in the mind of McFate, with my having invented that little expedition before ever learning of it as I did now. Vladimir Nabokov — Lolita 71 What next? I proceeded to the business center of Parkington and devoted the whole afternoon (the weather had cleared, the wet town was like silver-and-glass) to buying beautiful things for Lo. Goodness, what crazy purchases were prompted by the poignant predilection Humbert had in those days for check weaves, bright cottons, frills, puffed-outshortsleeves,softpleats,snug-fittingbodicesandgenerouslyfullskirts!OhLolita, you are my girl, as Vee was Poe’s and Bea Dante’s, and what little girl would not like to whirl in a circular skirt and scanties? Did I have something special in mind? coaxing voices asked me. Swimming suits? We have them in all shades. Dream pink, frosted aqua, glans mauve, tulip red, oolala black. What about playsuits? Slips? No slips. Lo and I loathed slips. One of my guides in these matters was an anthropometric entry made by her mother on Lo’s twelfth birthday (the reader remembers that Know-Your-Child book). I had the feeling that Charlotte, moved by obscure motives of envy and dislike, had added an inch here, a pound there; but since the nymphet had no doubt grown somewhat in the last seven months, I thought I could safely accept most of those January measurements: hip girth, twenty-nine inches; thigh girth (just below the gluteal sulcus), seventeen; calf girth and neck circumference, eleven; chest circumference, twenty-seven; upper arm girth, eight; waist, twenty-three; stature, fifty-seveninches;weight,seventy-eight pounds; figure,linear;intelligencequotient,?2?;vermiformappendixpresent, thank God. Apart from measurements, I could of course visualize Lolita with hallucinational lucidity; and nursing as I did a tingle on my breastbone at the exact spot her silky top had come level once or twice with my heart; and feeling as I did her warm weight in my lap (so that, in a sense, I was always “with Lolita” as a woman is “with child”), I was not surprised to discover later that my computation had been more or less correct. Having moreover studied a midsummer sale book, it was with a very knowing air that I examined various pretty articles, sport shoes, sneakers, pumps of crushed kid for crushed kids. Thepaintedgirlinblackwhoattendedtoallthesepoignantneedsof mine turned parental scholarship and precise description into commercial euphemisms, such as “petite.” Another, much older woman, in a white dress, with a pancake make-up, seemed to be oddly impressed by my knowledge of junior fashions; perhaps I had a midget for mistress; so, when shown a skirt with “cute” pockets in front, I intentionally put a naïve male question and was rewarded by a smiling demonstration of the way the zipper worked in the back of the skirt. I had next great fun with all kinds of shorts and briefs — phantom little Lolitas dancing, falling, daisying all over the counter. We rounded up the deal with some prim cotton pajamas in popular butcher-boy style. Humbert, the popular butcher. Thereisatouchofthemythologicalandtheenchantedinthoselargestoreswhereaccording to ads a career girl can get a complete desk-to-date wardrobe, and where little sister can dream of the day when her wool jersey will make the boys in the back row of the classroom drool. Life-size plastic figuresofsnubbed-nosedchildrenwithdun-colored, greenish, brown-dotted, faunish faces floatedaroundme.IrealizedIwas 72 Lolita — Vladimir Nabokov the only shopper in that rather eerie place where I moved about fishlike,inaglaucous aquarium. I sensed strange thoughts form in the minds of the languid ladies that escorted me from counter to counter, from rock ledge to seaweed, and the belts and the bracelets I chose seemed to fall from siren hands into transparent water. I bought an elegant valise, had my purchases put into it, and repaired to the nearest hotel, well pleased with my day. Somehow, in connection with that quiet poetical afternoon of fastidious shopping, I recalled the hotel or inn with the seductive name of TheEnchantedHunterswithCharlotte had happened to mention shortly before my liberation. With the help of a guidebook I located it in the secluded town of Briceland, a four-hour drive from Lo’s camp. I could have telephoned but fearing my voice might go out of control and lapse into coy croaks of broken English, I decided to send a wire ordering a room with twin beds for the next night. What a comic, clumsy, wavering Prince Charming I was! How some of my readers will laugh at me when I tell them the trouble I had with the wording of my telegram! What should I put: Humbert and daughter? Humberg and small daughter? Homberg and immature girl? Homburg and child? Thedrollmistake — the “g” at the end — which eventually came through may have been a telepathic echo of these hesitations of mine. And then, in the velvet of a summer night, my broodings over the philter I had with me! Oh miserly Hamburg! Was he not a very Enchanted Hunter as he deliberated with himself over his boxful of magic ammunition? To rout the monster of insomnia should he try himself one of those amethyst capsules? Therewerefortyofthem, all told — forty nights with a frail little sleeper at my throbbing side; could I rob myself of one such night in order to sleep? Certainly not: much too precious was each tiny plum, each microscopic planetarium with its live startdust. Oh, let me be mawkish for the nonce! I am so tired of being cynical. 26 Thisdailyheadacheintheopaqueairofthistombaljailisdisturbing,butImustpersevere. Have written more than a hundred pages and not got anywhere yet. My calendar is getting confused. ThatmusthavebeenaroundAugust?5,?947.Don’tthinkIcango on. Heart, head — everything. Lolita, Lolita, Lolita, Lolita, Lolita, Lolita, Lolita, Lolita, Lolita, Lolita. Repeat till the page is full, printer. 27 Still in Parkington. Finally, I did achieve an hour’s slumber — from which I was aroused by gratuitous and horribly exhausting congress with a small hairy hermaphrodite, a total stranger. By then it was six in the morning, and it suddenly occurred Vladimir Nabokov — Lolita 73 to me it might be a good thing to arrive at the camp earlier than I had said. From Parkington I had still a hundred miles to go, and there would be more than that to the Hazy Hills and Briceland. If I had said I would come for Dolly in the afternoon, it was only because my fancy insisted on merciful night falling as soon as possible upon my impatience. But now I foresaw all kinds of misunderstandings and was all a-jitter lest delay might give her the opportunity of some idle telephone call to Ramsdale. However, when at 9.30 a.m. I attempted to start, I was confronted by a dead battery, and noon was nigh when at last I left Parkington. I reached my destination around half past two; parked my car in a pine grove where a green-shirted, redheaded impish lad stood throwing horseshoes in sullen solitude; was laconically directed by him to an officeina stuccocottage;ina dyingstate, had to endure for several minutes the inquisitive commiseration of the camp mistress, a sluttish worn out female with rusty hair. Dolly she said was all packed and ready to go. She knew her mother was sick but not critically. Would Mr. Haze, I mean, Mr. Humbert, care to meet the camp counselors? Or look at the cabins where the girls live? Each dedicated to a Disney creature? Or visit the Lodge? Or should Charlie be sent over to fetch her? ThegirlswerejustfinishingfixingtheDiningRoomfora dance. (And perhaps afterwards she would say to somebody or other: “Thepoorguylooked like his own ghost.”) Let me retain for a moment that scene in all its trivial and fateful detail: hag Holmes writing out a receipt, scratching her head, pulling a drawer out of her desk, pouring change into my impatient palm, then neatly spreading a banknote over it with a bright “…and five!”;photographsofgirl-children;somegaudymothorbutterfly,still alive, safely pinned to the wall (“nature study”); the framed diploma of the camp’s dietitian; my trembling hands; a card produced by efficientHolmeswitha reportof Dolly Haze’s behavior for July (“fair to good; keen on swimming and boating”); a sound of trees and birds, and my pounding heart… I was standing with my back to the open door, and then I felt the blood rush to my head as I heart her respiration and voice behind me. She arrived dragging and bumping her heavy suitcase. “Hi!” she said, and stood still, looking at me with sly, glad eyes, her soft lips parted in a slightly foolish but wonderfully endearing smile. She was thinner and taller, and for a second it seemed to me her face was less pretty than the mental imprint I had cherished for more than a month: her cheeks looked hollowed and too much lentigo camouflagedherrosyrusticfeatures;andthatfirstimpression(averynarrowhumanintervalbetweentwotigerheartbeats)carriedthe clear implication that all widower Humbert had to do, wanted to do, or would do, was to give this wan-looking though sun-colored little orphan au yeux battus (and even those plumbaceous umbrae under her eyes bore freckles) a sound education, a healthy and happy girlhood, a clean home, nice girl-friends of her age among whom (if the fates deigned to repay me) I might find,perhaps,aprettylittleMägdlein for Herr Doktor Humbert alone. But “in a wink,” as the Germans say, the angelic line of conduct was erased, and I overtook my prey (time moves ahead of our fancies!), and 74 Lolita — Vladimir Nabokov she was my Lolita again — in fact, more of my Lolita than ever. I let my hand rest on her warm auburn head and took up her bag. She was all rose and honey, dressed in her brightest gingham, with a pattern of little red apples, and her arms and legs were of a deep golden brown, with scratches like tiny dotted lines of coagulated rubies, and the ribbed cuffsofherwhitesockswereturneddownattherememberedlevel,andbecause of her childish gait, or because I had memorized her as always wearing heelless shoes, her saddle oxfords looked somehow too large and too high-heeled for her. Good-bye, Camp Q, merry Camp Q. Good-bye, plain unwholesome food, good-bye Charlie boy. In the hot car she settled down beside me, slapped a prompt flyonherlovely knee; then, her mouth working violently on a piece of chewing gum, she rapidly cranked down the window on her side and settled back again. We sped through the striped and speckled forest. “How’s Mother?” she asked dutifully. I said the doctors did not quite know yet what the trouble was. Anyway, something abdominal. Abominable? No, abdominal. We would have to hang around for a while. Thehospitalwasinthecountry,nearthegaytownofLepingville,wherea great poet had resided in the early nineteenth century and where we would take in all the shows. She thought it a peachy idea and wondered if we could make Lepingville before nine p.m. “We should be at Briceland by dinner time,” I said, “and tomorrow we’ll visit Lepingville. How was the hike? Did you have a marvelous time at the camp?” “Uh-huh.” “Sorry to leave?” “Un-un.” “Talk, Lo — don’t grunt. Tell me something.” “What thing, Dad?” (she let the word expand with ironic deliberation). “Any old thing.” “Okay, if I call you that?” (eyes slit at the road). “Quite.” “It’s a sketch, you know. When did you fall for my mummy?” “Some day, Lo, you will understand many emotions and situations, such as for example the harmony, the beauty of spiritual relationship.” “Bah!” said the cynical nymphet. Shallow lull in the dialogue, filledwithsomelandscape. “Look, Lo, at all those cows on that hillside.” “I think I’ll vomit if I look at a cow again.” “You know, I missed you terribly, Lo.” “I did not. Fact I’ve been revoltingly unfaithful to you, but it does not matter one bit, because you’ve stopped caring for me, anyway. You drive much faster than my mummy, mister.” I slowed down from a blind seventy to a purblind fifty. “Why do you think I have ceased caring for you, Lo?” Vladimir Nabokov — Lolita 75 “Well, you haven’t kissed me yet, have you?” Inly dying, inly moaning, I glimpsed a reasonably wide shoulder of road ahead, and bumped and wobbled into the weeds. Remember she is only a child, remember she is only — Hardly had the car come to a standstill than Lolita positively flowedintomyarms.Not daring, not daring let myself go — not even daring let myself realize that this (sweet wetness and trembling fire)wasthebeginningoftheineffablelifewhich,ablyassisted by fate, I had finallywilledintobeing—notdaringreallykissher,Itouchedher hot, opening lips with the utmost piety, tiny sips, nothing salacious; but she, with an impatient wriggle, pressed her mouth to mine so hard that I felt her big front teeth and shared in the peppermint taste of her saliva. I knew, of course, it was but an innocent game on her part, a bit of backfischfooleryinimitationofsomesimulacrumof fake romance, and since (as the psychotherapist, as well as the rapist, will tell you) the limits and rules of such girlish games are fluid,oratleasttoochildishlysubtlefor the senior partner to grasp — I was dreadfully afraid I might go too far and cause her to start back in revulsion and terror. And, as above all I was agonizingly anxious to smuggle her into the hermetic seclusion of TheEnchantedHunters,andwehadstill eighty miles to go, blessed intuition broke our embrace — a split second before a highway patrol car drew up alongside. Florid and beetle-browed, its driver stared at me: “Happen to see a blue sedan, same make as yours, pass you before the junction?” “Why, no.” “We didn’t,” said Lo, eagerly leaning across me, her innocent hand on my legs, “but are you sure it was blue, because —” Thecop(whatshadowofuswasheafter?)gavethelittlecolleenhisbestsmileand went into a U-turn. We drove on. “Thefruithead!”remarkedLo.“Heshouldhavenabbedyou.” “Why me for heaven’s sake?” “Well, the speed in this bum state is fifty,and—No,don’tslowdown,you,dullbulb. He’s gone now.” “We have still quite a stretch,” I said, “and I want to get there before dark. So be a good girl.” “Bad, bad girl,” said Lo comfortably. “Juvenile delickwent, but frank and fetching. Thatlightwasred.I’veneverseensuchdriving.” We rolled silently through a silent townlet. “Say, wouldn’t Mother be absolutely mad if she found out we were lovers?” “Good Lord, Lo, let us not talk that way.” “But we are lovers, aren’t we?” “Not that I know of. I think we are going to have some more rain. Don’t you want to tell me of those little pranks of yours in camp?” “You talk like a book, Dad.” 76 Lolita — Vladimir Nabokov “What have you been up to? I insist you tell me.” “Are you easily shocked?” “No. Go on.” “Let us turn into a secluded lane and I’ll tell you.” “Lo, I must seriously ask you not to play the fool. Well?” “Well — I joined in all the activities that were offered.” “Ensuite?” “Ansooit, I was taught to live happily and richly with others and to develop a wholesome personality. Be a cake, in fact.” “Yes. I saw something of the sort in the booklet.” “We loved the sings around the fireinthebigstonefireplaceorunderthedarnedstars, where every girl merged her own spirit of happiness with the voice of the group.” “Your memory is excellent, Lo, but I must trouble you to leave out the swear words. Anything else?” “TheGirlScout’smotto,”saidLorhapsodically,“isalsomine.Ifillmylifewithworthwhile deeds such as — well, never mind what. My duty is — to be useful. I am a friend to male animals. I obey orders. I am cheerful. Thatwasanotherpolicecar.I am thrifty and I am absolutely filthyinthought,wordanddeed.” “Now I do hope that’s all, you witty child.” “Yep. That’sall.No—waitasec.Webakedinareflectoroven.Isn’tthatterrific?” “Well, that’s better.” “We washed zillions of dishes. ‘Zillions’ you know is schoolmarm’s slang for many-many-many-many. Oh yes, last but not least, as Mother says — Now let me see — what was it? I know we made shadowgraphs. Gee, what fun.” “C’est bien tout?” “C’est. Except for one little thing, something I simply can’t tell you without blushing all over.” “Will you tell it me later?” “If we sit in the dark and you let me whisper, I will. Do you sleep in your old room or in a heap with Mother?” “Old room. Your mother may have to undergo a very serious operation, Lo.” “Stop at that candy bar, will you,” said Lo. Sitting on a high stool, a band of sunlight crossing her bare brown forearm, Lolita was served an elaborate ice-cream concoction topped with synthetic syrup. It was erected and brought her by a pimply brute of a boy in a greasy bow-tie who eyed my fragile child in her thin cotton frock with carnal deliberation. My impatience to reach Briceland and TheEnchantedHunterswasbecomingmorethanIcouldendure.Fortunately she dispatched the stuffwithherusualalacrity. “How much cash do you have?” I asked. “Not a cent,” she said sadly, lifting her eyebrows, showing me the empty inside of her money purse. Vladimir Nabokov — Lolita 77 “Thisisamatterthatwillbemendedinduetime,”Irejoinedarchly.“Areyoucoming?” “Say, I wonder if they have a washroom.” “you are not going there,” I said Firmly. “It is sure to be a vile place. Do come on.” She was on the whole an obedient little girl and I kissed her in the neck when we got back into the car. “Don’t do that,” she said looking at me with unfeigned surprise. “Don’t drool on me. You dirty man.” She rubbed the spot against her raised shoulder. “Sorry,” I murmured. “I’m rather fond of you, that’s all.” We drove under a gloomy sky, up a winding road, then down again. “Well, I’m also sort of fond of you,” said Lolita in a delayed soft voice, with a sort of sigh, and sort of settled closer to me. (Oh, my Lolita, we shall never get there!) Dusk was beginning to saturate pretty little Briceland, its phony colonial architecture, curiosity sops and imported shade trees, when we drove through the weakly lighted streets in search of the Enchanted Hunters. Theair,despiteasteadydrizzle beading it, was warm and green, and a queue of people, mainly children and old men, had already formed before the box officeofa moviehouse,drippingwithjewel-fires. “Oh, I want to see that picture. Let’s go right after dinner. Oh, let’s!” “We might,” chanted Humbert — knowing perfectly well, the sly tumescent devil, that by nine, when his show began, she would be dead in his arms. “Easy!” cried Lo, lurching forward, as an accursed truck in front of us, its backside carbuncles pulsating, stopped at a crossing. If we did not get to the hotel soon, immediately, miraculously, in the very next block, I felt I would lose all control over the Haze jalopy with its ineffectualwipersandwhimsical brakes; but the passers-by I applied to for directions were either strangers themselves or asked with a frown “Enchanted what?” as if I were a madman; or else they went into such complicated explanations, with geometrical gestures, geographical generalities and strictly local clues (…then bear south after you hit the court-house…) that I could not help losing my way in the maze of their well-meaning gibberish. Lo, whose lovely prismatic entrails had already digested the sweetmeat, was looking forward to a big meal and had begun to fidget.Astome,althoughIhadlongbecome used to a kind of secondary fate (McFate’s inept secretary, so to speak) pettily interfering with the boss’s generous magnificentplan—togrindandgropethroughthe avenues of Briceland was perhaps the most exasperating ordeal I had yet faced. In later months I could laugh at my inexperience when recalling the obstinate boyish way in which I had concentrated upon that particular inn with its fancy name; for all along our route countless motor courts proclaimed their vacancy in neon lights, ready to accommodate salesmen, escaped convicts, impotents, family groups, as well as the most corrupt and vigorous couples. Ah, gentle drivers gliding through summer’s 78 Lolita — Vladimir Nabokov black nights, what frolics, what twists of lust, you might see from your impeccable highways if Kumfy Kabins were suddenly drained of their pigments and became as transparent as boxes of glass! ThemiracleIhankeredfordidhappenafterall.Amanandagirl,moreorlessconjoined in a dark car under dripping trees, told us we were in the heart of ThePark,but had only to turn left at the next trafficlightandtherewewouldbe.Wedidnotsee any next trafficlight— infact,TheParkwasas blackas thesinsit concealed—butsoon after falling under the smooth spell of a nicely graded curve, the travelers became aware of a diamond glow through the mist, then a gleam of lakewater appeared — and there it was, marvelously and inexorably, under spectral trees, at the top of a graveled drive — the pale palace of TheEnchantedHunters. A row of parked cars, like pigs at a trough, seemed at firstsighttoforbidaccess;butthen, by magic, a formidable convertible, resplendent, rubious in the lighted rain, came into motion — was energetically backed out by a broad-shouldered driver — and we gratefully slipped into the gap it had left. I immediately regretted my haste for I noticed that my predecessor had now taken advantage of a garage-like shelter nearby where there was ample space for another car; but I was too impatient to follow his example. “Wow! Looks swank,” remarked my vulgar darling squinting at the stucco as she crept out into the audible drizzle and with a childish hand tweaked loose the frock-fold that had struck in the peach-cleft-to quote Robert Browning. Under the arclights enlarged replicas of chestnut leaves plunged and played on white pillars. I unlocked the trunk compartment. A hunchbacked and hoary Negro in a uniform of sorts took our bags and wheeled them slowly into the lobby. It was full of old ladies and clergy men. Lolita sank down on her haunches to caress a pale-faced, blue-freckled, black-eared cocker spaniel swooning on the floralcarpetunderherhand—aswhowouldnot, my heart — while I cleared my throat through the throng to the desk. Thereabaldporcine old man — everybody was old in that old hotel — examined my features with a polite smile, then leisurely produced my (garbled) telegram, wrestled with some dark doubts, turned his head to look at the clock, and finallysaidhewasverysorry,hehadheld the room with the twin beds till half past six, and now it was gone. A religious convention, he said, had clashed with a flowershowinBriceland,and—“Thename,”I said coldly, “is not Humberg and not Humbug, but Herbert, I mean Humbert, and any room will do, just put in a cot for my little daughter. She is ten and very tired.” Thepinkoldfellowpeeredgood-naturedlyatLo—stillsquatting,listeninginprofile,lipsparted,towhatthedog’smistress,anancientladyswathedinvioletveils,was telling her from the depths of a cretonne easy chair. Whatever doubts the obscene fellow had, they were dispelled by that blossom-like vision. He said, he might still have a room, had one, in fact — with a double bed. As to the cot — “Mr. Potts, do we have any cots left?” Potts, also pink and bald, with white hairs growing out of his ears and other holes, would see what could be done. He came and spoke while I unscrewed my fountain pen. Impatient Humbert! Vladimir Nabokov — Lolita 79 “Our double beds are really triple,” Potts cozily said tucking me and my kid in. “One crowded night we had three ladies and a child like yours sleep together. I believe one of the ladies was a disguised man [my static]. However — would there be a spare cot in 49, Mr. Swine? “I think it went to the Swoons,” said Swine, the initial old clown. “We’ll manage somehow,” I said. “My wife may join us later — but even then, I suppose, we’ll manage.” Thetwopinkpigswerenowamongmybestfriends.Intheslowclearhandofcrime I wrote: Dr. Edgar H. Humbert and daughter, 342 Lawn Street, Ramsdale. A key (342!) was half-shown to me (magician showing object he is about to palm) — and handed over to Uncle Tom. Lo, leaving the dog as she would leave me some day, rose from her haunches; a raindrop fell on Charlotte’s grave; a handsome young Negress slipped open the elevator door, and the doomed child went in followed by her throat-clearing father and crayfishTomwiththebags. Parody of a hotel corridor. Parody of silence and death. “Say, it’s our house number,” said cheerful Lo. Therewasadoublebed,amirror,adoublebedinthemirror,aclosetdoorwithmirror, a bathroom door ditto, a blue-dark window, a reflectedbedthere,thesameinthe closet mirror, two chairs, a glass-topped table, two bedtables, a double bed: a big panel bed, to be exact, with a Tuscan rose chenille spread, and two frilled, pink-shaded nightlamps, left and right. I was tempted to place a five-dollarbillinthatsepiapalm,butthoughtthelargesse might be misconstrued, so I placed a quarter. Added another. He withdrew. Click. Enfinseuls. “Are we going to sleep in one room?” said Lo, her features working in that dynamic way they did — not cross or disgusted (though plain on the brink of it) but just dynamic — when she wanted to load a question with violent significance. “I’ve asked them to put in a cot. Which I’ll use if you like.” “You are crazy,” said Lo. “Why, my darling?” “Because, my dahrling, when dahrling Mother findsoutshe’lldivorceyouandstrangle me.” Just dynamic. Not really taking the matter too seriously. “Now look here,” I said, sitting down, while she stood, a few feet away from me, and stared at herself contentedly, not unpleasantly surprised at her own appearance, fillingwith her own rosy sunshine the surprised and pleased closet-door mirror. “Look here, Lo. Let’s settle this once for all. For all practical purposes I am your father. I have a feeling of great tenderness for you. In your mother’s absence I am responsible for your welfare. We are not rich, and while we travel, we shall be obliged — we shall be thrown a good deal together. Two people sharing one room, inevitably enter into a kind — how shall I say — a kind —” 80 Lolita — Vladimir Nabokov “Thewordisincest,”saidLo—andwalkedintothecloset,walkedoutagainwitha young golden giggle, opened the adjoining door, and after carefully peering inside with her strange smoky eyes lest she make another mistake, retired to the bathroom. I opened the window, tore offmysweat-drenchedshirt,changed,checkedthepillvial in my coat pocket, unlocked the — She drifted out. I tried to embrace her: casually, a bit of controlled tenderness before dinner. She said: “Look, let’s cut out the kissing game and get something to eat.” It was then that I sprang my surprise. Oh, what a dreamy pet! She walked up to the open suitcase as if stalking it from afar, at a kind of slow-motion walk, peering at that distant treasure box on the luggage support. (Was there something wrong, I wondered, with those great gray eyes of hers, or were we both plunged in the same enchanted mist?) She stepped up to it, lifting her rather high-heeled feet rather high, and bending her beautiful boy-knees while she walked through dilating space with the lentor of one walking under water or in a flightdream.Thensheraisedbythearmletsa copper-colored,charmingandquite expensive vest, very slowly stretching it between her silent hands as if she were a bemused bird-hunter holding his breath over the incredible bird he spreads out by the tips of its flamingwings.Then(whileI stoodwaitingforher)shepulledoutthe slow snake of a brilliant belt and tried it on. Thenshecreptintomywaitingarms,radiant,relaxed,caressingmewithhertender,mysterious, impure, indifferent,twilighteyes—foralltheworld,likethecheapestofcheap cuties. For that is what nymphets imitate — while we moan and die. “What’s the katter with misses?” I muttered (word-control gone) into her hair. “If you must know,” she said, “you do it the wrong way.” “Show, wight ray.” “All in good time,” responded the spoonerette. Seva ascendes, pulsata, brulans, kitzelans, dementissima. Elevator clatterans, pausa, clatterans, populus in corridoro. Hanc nisi mors mihi adimet nemo! Juncea puellula, jo pensavo fondissime, nobserva nihil quidquam; but, of course, in another moment I might have committed some dreadful blunder; fortunately, she returned to the treasure box. From the bathroom, where it took me quite a time to shift back into normal gear for a humdrum purpose, I heard, standing, drumming, retaining my breath, my Lolita’s “oo’s” and “gee’s” of girlish delight. She had used the soap only because it was sample soap. “Well, come on, my dear, if you are as hungry as I am.” And so to the elevator, daughter swinging her old white purse, father walking in front (nota bene: never behind, she is not a lady). As we stood (now side by side) waiting to be taken down, she threw back her head, yawned without restraint and shook her curls. “When did they make you get up at that camp?” Vladimir Nabokov — Lolita 81 “Half-past —” she stifledanotheryawn—“six”—yawninfullwithashiverofallher frame. “Half-past,” she repeated, her throat fillingupagain. Thediningroommetuswithasmelloffriedfatandafadedsmile.Itwasaspacious and pretentious place with maudlin murals depicting enchanted hunters in various postures and states of enchantment amid a medley of pallid animals, dryads and trees. A few scattered old ladies, two clergymen, and a man in a sports coat were finishingtheirmealsinsilence.Thediningroomclosedatnine,andthegreen-clad,poker-faced serving girls were, happily, in a desperate hurry to get rid of us. “Does not he look exactly, but exactly, like Quilty?” said Lo in a soft voice, her sharp brown elbow not pointing, but visibly burning to point, at the lone diner in the loud checks, in the far corner of the room. “Like our fat Ramsdale dentist?” Lo arrested the mouthful of water she had just taken, and put down her dancing glass. “Course not,” she said with a splutter of mirth. “I meant the writer fellow in the Dromes ad.” Oh, Fame! Oh, Femina! When the dessert was plunked down — a huge wedge of cherry pie for the young lady and vanilla ice cream her protector, most of which she expeditiously added to her pie — I produced a small vial containing Papa’s Purple Pills. As I look back at those seasick murals, at that strange and monstrous moment, I can only explain my behavior then by the mechanism of that dream vacuum wherein revolves a deranged mind; but at the time, it all seemed quite simple and inevitable to me. I glanced around, satisfiedmyselfthatthelastdinerhadleft,removedthestopped,andwiththeutmostdeliberation tipped the philter into my palm. I had carefully rehearsed before a mirror the gesture of clapping my empty hand to my open mouth and swallowing a (fictitious) pill. As I expected, she pounced upon the vial with its plump, beautifully colored capsules loaded with Beauty’s Sleep. “Blue!” she exclaimed. “Violet blue. What are they made of?” “Summer skies,” I said, “and plums and figs,andthegrapebloodofemperors.” “No, seriously — please.” “Oh, just Purpills. Vitamin X. Makes one strong as an ox or an ax. Want to try one?” Lolita stretched out her hand, nodding vigorously. I had hoped the drug would work fast. It certainly did. She had had a long long day, she had gone rowing in the morning with Barbara whose sister was Waterfront Director, as the adorable accessible nymphet now started to tell me in between suppressed palate-humping yawns, growing in volume — oh, how fast the magic potion worked! — and had been active in other ways too. Themoviethathadvaguelyloomedin her mind was, of course, by the time we watertreaded out of the dining room, forgotten. As we stood in the elevator, she leaned against me, faintly smiling — wouldn’t you like me to tell you? — half closing her dark-lidded eyes. “Sleepy, huh?” said Un82 Lolita — Vladimir Nabokov cle Tom who was bringing up the quiet Franco-Irish gentleman and his daughter as well as two withered women, experts in roses. Theylookedwithsympathyatmyfrail,tanned, tottering, dazed rosedarling. I had almost to carry her into our room. There,she sat down on the edge of the bed, swaying a little, speaking in dove-dull, long-drawn tones. “If I tell you — if I tell you, will you promise [sleepy, so sleepy — head lolling, eyes going out], promise you won’t make complaints?” “Later, Lo. Now go to bed. I’ll leave you here, and you go to bed. Give you ten minutes.” “Oh, I’ve been such a disgusting girl,” she went on, shaking her hair, removing with slow fingersavelvethairribbon.“Lemmetellyou—” “Tomorrow, Lo. Go to bed, go to bed — for goodness sake, to bed.” I pocketed the key and walked downstairs. 28 Gentlewomen of the jury! Bear with me! Allow me to take just a tiny bit of your precious time. So this was le grand moment. I had left my Lolita still sitting on the edge of the abysmal bed, drowsily raising her foot, fumbling at the shoelaces and showing as she did so the nether side of her thigh up to the crotch of her panties — she had always been singularly absentminded, or shameless, or both, in matters of legshow. This,then,wasthehermeticvisionofherwhichIhadlockedin—aftersatisfyingmyself that the door carried no inside bolt. Thekey,withitsnumbereddanglerofcarvedwood, became forthwith the weighty sesame to a rapturous and formidable future. It was mine, it was part of my hot hairy fist.Inafewminutes—say,twenty,sayhalf-an-hour, sicher ist sicher as my uncle Gustave used to say — I would let myself into that “342” and findmynymphet,mybeautyandbride,imprisonedinhercrystalsleep.Jurors! If my happiness could have talked, it would have filledthatgenteelhotelwitha deafening roar. And my only regret today is that I did not quietly deposit key “342” at the office,andleavethetown,thecountry,thecontinent,thehemisphere,— indeed,the globe — that very same night. Let me explain. I was not unduly disturbed by her self-accusatory innuendoes. I was still firmlyresolvedtopursuemypolicyofsparingherpuritybyoperatingonlyin the stealth of night, only upon a completely anesthetized little nude. Restraint and reverence were still my motto — even if that “purity” (incidentally, thoroughly debunked by modern science) had been slightly damaged through some juvenile erotic experience, no doubt homosexual, at that accursed camp of hers. Of course, in my old-fashioned, old-world way, I, Jean-Jacques Humbert, had taken for granted, when I firstmet her, that she was as unravished as the stereotypical notion of “normal child” had been since the lamented end of the Ancient World B.C. and its fascinating practices. We are not surrounded in our enlighted era by little slave flowersthatcanbecasually Vladimir Nabokov — Lolita 83 plucked between business and bath as they used to be in the days of the Romans; and we do not, as dignifiedOrientalsdidinstillmoreluxurioustimes,usetinyentertainersfore and aft between the mutton and the rose sherbet. Thewholepointisthattheoldlink between the adult world and the child world has been completely severed nowadays by new customs and new laws. Despite my having dabbled in psychiatry and social work, I really knew very little about children. After all, Lolita was only twelve, and no matter what concessions I made to time and place — even bearing in mind the crude behavior of American schoolchildren — I still was under the impression that whatever went on among those brash brats, went on at a later age, and in a differentenvironment. Therefore(toretrievethethreadofthisexplanation)themoralistinmeby-passed the issue by clinging to conventional notions of what twelve-year-old girls should be. Thechildtherapistinme(afake,asmostofthemare—butnomatter)regurgitated neo-Freudian hash and conjured up a dreaming and exaggerating Dolly in the “latency” period of girlhood. Finally, the sensualist in me (a great and insane monster) had no objection to some depravity in his prey. But somewhere behind the raging bliss, bewildered shadows conferred — and not to have heeded them, this is what I regret! Human beings, attend! I should have understood that Lolita had already proved to be something quite differentfrominnocentAnnabel,andthatthenympheanevilbreathing through every pore of the fey child that I had prepared for my secret delectation, would make the secrecy impossible, and the delectation lethal. I should have known (by the signs made to me by something in Lolita — the real child Lolita or some haggard angel behind her back) that nothing but pain and horror would result from the expected rapture. Oh, winged gentlemen of the jury! And she was mine, she was mine, the key was in my fist,myfistwasinmypocket,she was mine. In the course of evocations and schemes to which I had dedicated so many insomnias, I had gradually eliminated all the superfluousblur,andbystacking level upon level of translucent vision, had evolved a finalpicture.Naked,exceptfor one sock and her charm bracelet, spread-eagled on the bed where my philter had felled her — so I foreglimpsed her; a velvet hair ribbon was still clutched in her hand; her honey-brown body, with the white negative image of a rudimentary swimsuit patterned against her tan, presented to me its pale breastbuds; in the rosy lamplight, a little pubic flossglistenedonitsplumphillock.Thecoldkeywithitswarmwoodenaddendum was in my pocket. I wandered through various public rooms, glory below, gloom above: for the look of lust always is gloomy; lust is never quite sure — even when the velvety victim is locked up in one’s dungeon — that some rival devil or influentialgodmaystillnotabolishone’s prepared triumph. In common parlance, I needed a drink; but there was no barroom in that venerable place full of perspiring philistines and period objects. I drifted to the Men’s Room. There,apersonintheclericalblack—a“heartyparty”comme on dit — checking with the assistance of Vienna, if it was still there, inquired of me how I had liked Dr. Boyd’s talk, and looked puzzled when I (King Sigmund the Second) said Boyd was quite a boy. Upon which, I neatly chucked the tissue paper 84 Lolita — Vladimir Nabokov I had been wiping my sensitive fingertipswithintothereceptacleprovidedforit,andsallied lobbyward. Comfortably resting my elbows on the counter, I asked Mr. Potts was he quite sure my wife had not telephoned, and what about that cot? He answered she had not (she was dead, of course) and the cot would be installed tomorrow if we decided to stay on. From a big crowded place called TheHunters’Hallcameasoundof many voices discussing horticulture or eternity. Another room, called TheRaspberryRoom, all bathed in light, with bright little tables and a large one with “refreshments,” was still empty except for a hostess (that type of worn woman with a glassy smile and Charlotte’s manner of speaking); she floateduptometoaskifIwasMr.Braddock, because if so, Miss Beard had been looking for me. “What a name for a woman,” I said and strolled away. In and out of my heart flowedmyrainbowblood.Iwouldgivehertillhalf-past-nine. Going back to the lobby, I found there a change: a number of people in floraldresses or black cloth had formed little groups here and there, and some elfishchanceofferedmethesightofadelightfulchildofLolita’sage,inLolita’stypeoffrock,butpure white, and there was a white ribbon in her black hair. She was not pretty, but she was a nymphet, and her ivory pale legs and lily neck formed for one memorable moment a most pleasurable antiphony (in terms of spinal music) to my desire for Lolita, brown and pink, flushedandfouled.Thepalechildnoticedmygaze(whichwasreallyquite casual and debonair), and being ridiculously self-conscious, lost countenance completely, rolling her eyes and putting the back of her hand to her cheek, and pulling at the hem of her skirt, and finallyturningherthinmobileshoulderbladestomein specious chat with her cow-like mother. I left the loud lobby and stood outside, on the white steps, looking at the hundreds of powdered bugs wheeling around the lamps in the soggy black night, full of ripple and stir. All I would do — all I would dare do — would amount to such a trifle…Suddenly I was aware that in the darkness next to me there was somebody sitting in a chair on the pillared porch. I could not really see him but what gave him away was the rasp of a screwing off,thenadiscreetgurgle,thenthefinalnoteofa placidscrewing on. I was about to move away when his voice addressed me: “Where the devil did you get her?” “I beg your pardon?” “I said: the weather is getting better.” “Seems so.” “Who’s the lassie?” “My daughter.” “You lie — she’s not.” “I beg your pardon?” “I said: July was hot. Where’s her mother?” “Dead.” “I see. Sorry. By the way, why don’t you two lunch with me tomorrow. Thatdreadful crowd will be gone by then.” Vladimir Nabokov — Lolita 85 “We’ll be gone too. Good night.” “Sorry. I’m pretty drunk. Good night. Thatchildofyoursneedsalotofsleep.Sleepis a rose, as the Persians say. Smoke?” “Not now.” He struck a light, but because he was drunk, or because the wind was, the flameillumined not him but another person, a very old man, one of those permanent guests of old hotels — and his white rocker. Nobody said anything and the darkness returned to its initial place. ThenIheardtheold-timercoughanddeliverhimselfofsomesepulchral mucus. I left the porch. At least half an hour in all had elapsed. I ought to have asked for a sip. Thestrainwasbeginningtotell.Ifaviolinstringcanache,thenIwasthatstring. But it would have been unseemly to display any hurry. As I made my way through a constellation of fixedpeopleinonecornerofthelobby,therecameablinding flash—andbeamingDr.Braddock,twoorchid-ornamentalizedmatrons,thesmallgirl in white, and presumably the bared teeth of Humbert Humbert sidling between the bridelike lassie and the enchanted cleric, were immortalized — insofar as the texture and print of small-town newspapers can be deemed immortal. A twittering group had gathered near the elevator. I again chose the stairs. 342 was near the fireescape.One could still — but the key was already in the lock, and then I was in the room. 29 Thedoorofthelightedbathroomstoodajar;inadditiontothat,askeletonglowcamethough the Venetian blind from the outside arclights; these intercrossed rays penetrated the darkness of the bedroom and revealed the following situation. Clothed in one of her old nightgowns, my Lolita lay on her side with her back to me, in the middle of the bed. Her lightly veiled body and bare limbs formed a Z. She had put both pillows under her dark tousled head; a band of pale light crossed her top vertebrae. I seemed to have shed my clothes and slipped into pajamas with the kind of fantastic instantaneousness which is implied when in a cinematographic scene the process of changing is cut; and I had already placed my knee on the edge of the bed when Lolita turned her head and stared at me though the striped shadows. Now this was something the intruder had not expected. Thewholepill-spiel(a rather sordid affair,entre nous soit dit) had had for object a fastness of sleep that a whole regiment would not have disturbed, and here she was staring at me, and thickly calling me “Barbara.” Barbara, wearing my pajamas which were much too tight for her, remained poised motionless over the little sleep-talker. Softly, with a hopeless sigh, Dolly turned away, resuming her initial position. For at least two minutes I waited and strained on the brink, like that tailor with his homemade parachute forty years ago when about to jump from the EiffelTower.Herfaintbreath86 Lolita — Vladimir Nabokov ing had the rhythm of sleep. Finally I heaved myself onto my narrow margin of bed, stealthily pulled at the odds and ends of sheets piled up to the south of my stone-cold heels — and Lolita lifted her head and gaped at me. As I learned later from a helpful pharmaceutist, the purple pill did not even belong to the big and noble family of barbiturates, and though it might have induced sleep in a neurotic who believed it to be a potent drug, it was too mild a sedative to affectfor any length of time a wary, albeit weary, nymphet. Whether the Ramsdale doctor was a charlatan or a shrewd old rogue, does not, and did not, really matter. What mattered, was that I had been deceived. When Lolita opened her eyes again, I realized that whether or not the drug might work later in the night, the security I had relied upon was a sham one. Slowly her head turned away and dropped onto her unfair amount of pillow. I lay quite still on my brink, peering at her rumpled hair, at the glimmer of nymphet flesh,wherehalfahaunchandhalfashoulderdimlyshowed,andtryingtogauge the depth of her sleep by the rate of her respiration. Some time passed, nothing changed, and I decided I might risk getting a little closer to that lovely and maddening glimmer; but hardly had I moved into its warm purlieus than her breathing was suspended, and I had the odious feeling that little Dolores was wide awake and would explode in screams if I touched her with any part of my wretchedness. Please, reader: no matter your exasperation with the tenderhearted, morbidly sensitive, infinitely circumspect hero of my book, do not skip these essential pages! Imagine me; I shall not exist if you do not imagine me; try to discern the doe in me, trembling in the forest of my own iniquity; let’s even smile a little. After all, there is no harm in smiling. For instance (I almost wrote “frinstance”), I had no place to rest my head, and a fitofheartburn(theycallthosefries“French,” grand Dieu!) was added to my discomfort. She was again fast asleep, my nymphet, but still I did not dare to launch upon my enchanted voyage. La Petite Dormeuse ou l’Amant Ridicule. Tomorrow I would stuffher with those earlier pills that had so thoroughly numbed her mummy. In the glove compartment — or in the Gladstone bag? Should I wait a solid hour and then creep up again? Thescienceofnympholepsyisaprecisescience.Actualcontactwoulddoitin one second flat.Aninterspaceofamillimeterwoulddoitinten.Letuswait. ThereisnothinglouderthananAmericanhotel;and,mindyou,thiswassupposed to be a quiet, cozy, old-fashioned, homey place — “gracious living” and all that stuff.Theclatteroftheelevator’sgate— sometwentyyardsnortheastofmyheadbutas clearly perceived as if it were inside my left temple — alternated with the banging and booming of the machine’s various evolutions and lasted well beyond midnight. Every now and then, immediately east of my left ear (always assuming I lay on my back, not daring to direct my viler side toward the nebulous haunch of my bed-mate), the corridor would brim with cheerful, resonant and inept exclamations ending in a volley of good-nights. When that stopped, a toilet immediately north of my cerebellum took over. It was a manly, energetic, deep-throated toilet, and it was used many times. Its gurgle and gush and long afterflowshookthewallbehindme.ThensomeVladimir Nabokov — Lolita 87 one in a southern direction was extravagantly sick, almost coughing out his life with his liquor, and his toilet descended like a veritable Niagara, immediately beyond our bathroom. And when finallyallthewaterfallshadstopped,andtheenchantedhunterswere sound asleep, the avenue under the window of my insomnia, to the west of my wake — a staid, eminently residential, dignifiedalleyofhugetrees—degeneratedintothe despicable haunt of gigantic trucks roaring through the wet and windy night. And less than six inches from me and my burning life, was nebulous Lolita! After a long stirless vigil, my tentacles moved towards her again, and this time the creak of the mattress did not awake her. I managed to bring my ravenous bulk so close to her that I felt the aura of her bare shoulder like a warm breath upon my cheek. And then, she sat up, gasped, muttered with insane rapidity something about boats, tugged at the sheets and lapsed back into her rich, dark, young unconsciousness. As she tossed, within that abundant flowofsleep,recentlyauburn,atpresentlunar,herarmstruckme across the face. For a second I held her. She freed herself from the shadow of my embrace — doing this not consciously, not violently, not with any personal distaste, but with the neutral plaintive murmur of a child demanding its natural rest. And again the situation remained the same: Lolita with her curved spine to Humbert, Humbert resting his head on his hand and burning with desire and dyspepsia. Thelatternecessitatedatriptothebathroomforadraftofwaterwhichisthebestmedicine I know in my case, except perhaps milk with radishes; and when I re-entered the strange pale-striped fastness where Lolita’s old and new clothes reclined in various attitudes of enchantment on pieces of furniture that seemed vaguely afloat,my impossible daughter sat up and in clear tones demanded a drink, too. She took the resilient and cold paper cup in her shadowy hand and gulped down its contents gratefully, her long eyelashes pointing cupward, and then, with an infantile gesture that carried more charm than any carnal caress, little Lolita wiped her lips against my shoulder. She fell back on her pillow (I had subtracted mine while she drank) and was instantly asleep again. I had not dared offerherasecondhelpingofthedrug,andhadnotabandonedhope that the firstmightstillconsolidatehersleep.Istartedtomovetowardher,readyfor any disappointment, knowing I had better wait but incapable of waiting. My pillow smelled of her hair. I moved toward my glimmering darling, stopping or retreating every time I thought she stirred or was about to stir. A breeze from wonderland had begun to affectmythoughts,andnowtheyseemedcouchedinitalics,asifthesurfacereflectingthemwerewrinkledbythephantasmofthatbreeze.Timeandagainmyconsciousness folded the wrong way, my shufflingbodyenteredthesphereofsleep,shuffledoutagain,andonceortwiceI caughtmyselfdriftingintoa melancholysnore.Mists of tenderness enfolded mountains of longing. Now and then it seemed to me that the enchanted prey was about to meet halfway the enchanted hunter, that her haunch was working its way toward me under the soft sand of a remote and fabulous beach; and then her dimpled dimness would stir, and I would know she was farther away from me than ever. 88 Lolita — Vladimir Nabokov If I dwell at some length on the tremors and groupings of that distant night, it is because I insist upon proving that I am not, and never was, and never could have been, a brutal scoundrel. ThegentleanddreamyregionsthoughwhichIcreptwerethe patrimonies of poets — not crime’s prowling ground. Had I reached my goal, my ecstasy would have been all softness, a case of internal combustion of which she would hardly have felt the heat, even if she were wide awake. But I still hoped she might gradually be engulfed in a completeness of stupor that would allow me to taste more than a glimmer of her. And so, in between tentative approximations, with a confusion of perception metamorphosing her into eyespots of moonlight or a fluffyfloweringbush, I would dream I regained consciousness, dream I lay in wait. In the firstantemeridianhourstherewasalullintherestlesshotelnight.Thenaround four the corridor toilet cascaded and its door banged. A little after fiveareverberating monologue began to arrive, in several installments, from some courtyard or parking place. It was not really a monologue, since the speaker stopped every few seconds to listen (presumably) to another fellow, but that other voice did not reach me, and so no real meaning could be derived from the part heard. Its matter-of-fact intonations, however, helped to bring in the dawn, and the room was already suffusedwith lilac gray, when several industrious toilets went to work, one after the other, and the clattering and whining elevator began to rise and take down early risers and downers, and for some minutes I miserably dozed, and Charlotte was a mermaid in a greenish tank, and somewhere in the passage Dr. Boyd said “Good morning to you” in a fruity voice, and birds were busy in the trees, and then Lolita yawned. Frigid gentlewomen of the jury! I had thought that months, perhaps years, would elapse before I dared to reveal myself to Dolores Haze; but by six she was wide awake, and by six fifteenweweretechnicallylovers.Iamgoingtotellyousomethingverystrange: it was she who seduced me. Upon hearing her firstmorningyawn,Ifeignedhandsomeprofiledsleep.I justdid not know what to do. Would she be shocked at findingmebyherside,andnotinsome spare bed? Would she collect her clothes and lock herself up in the bathroom? Would she demand to be taken at once to Ramsdale — to her mother’s bedside — back to camp? But my Lo was a sportive lassie. I felt her eyes on me, and when she uttered at last that beloved chortling note of hers, I knew her eyes had been laughing. She rolled over to my side, and her warm brown hair came against my collarbone. I gave a mediocre imitation of waking up. We lay quietly. I gently caressed her hair, and we gently kissed. Her kiss, to my delirious embarrassment, had some rather comical refinementsofflutterandprobewhichmademeconcludeshehadbeencoachedatan early age by a little Lesbian. No Charlie boy could have taught her that. As if to see whether I had my fillandlearnedthelesson,shedrewawayandsurveyedme.Hercheekbones were flushed,herfullunderlipglistened,mydissolutionwasnear.Allatonce, with a burst of rough glee (the sign of the nymphet!), she put her mouth to my ear — but for quite a while my mind could not separate into words the hot thunder of her whisper, and she laughed, and brushed the hair offherface,andtriedagain,and Vladimir Nabokov — Lolita 89 gradually the odd sense of living in a brand new, mad new dream world, where everything was permissible, came over me as I realized what she was suggesting. I answered I did not know what game she and Charlie had played. “You mean you have never —?” — her features twisted into a stare of disgusted incredulity. “You have never —” she started again. I took time out by nuzzling her a little. “Lay off,willyou,”shesaidwitha twangy whine, hastily removing her brown shoulder from my lips. (It was very curious the way she considered — and kept doing so for a long time — all caresses except kisses on the mouth or the stark act of love either “romantic slosh” or “abnormal”.) “You mean,” she persisted, now kneeling above me, “you never did it when you were a kid?” “Never,” I answered quite truthfully. “Okay,” said Lolita, “here is where we start.” However, I shall not bore my learned readers with a detailed account of Lolita’s presumption. Sufficeittosaythatnota traceofmodestydidI perceiveinthisbeautiful hardly formed young girl whom modern co-education, juvenile mores, the campfireracketandsoforthhadutterlyandhopelesslydepraved.Shesawthestarkactmerely as part of a youngster’s furtive world, unknown to adults. What adults did for purposes of procreation was no business of hers. My life was handled by little Lo in an energetic, matter-of-fact manner as if it were an insensate gadget unconnected with me. While eager to impress me with the world of tough kids, she was not quite prepared for certain discrepancies between a kid’s life and mine. Pride alone prevented her from giving up; for, in my strange predicament, I feigned supreme stupidity and had her have her way — at least while I could still bear it. But really these are irrelevant matters; I am not concerned with so-called “sex” at all. Anybody can imagine those elements of animality. A greater endeavor lures me on: to fixonceforalltheperilousmagic of nymphets. 30 I have to tread carefully. I have to speak in a whisper. Oh you, veteran crime reporter, you grave old usher, you once popular policeman, now in solitary confinementaftergracing that school crossing for years, you wretched emeritus read to by a boy! It would never do, would it, to have you fellows fall madly in love with my Lolita! had I been a painter, had the management of TheEnchantedHunterslostitsmindonesummerday and commissioned me to redecorate their dining room with murals of my own making, this is what I might have thought up, let me list some fragments: Therewouldhavebeenalake.Therewouldhavebeenanarborinflame-flower.Therewouldhavebeennaturestudies—atigerpursuingabirdofparadise,achoking snake sheathing whole the flayedtrunkofashoat.Therewouldhavebeena sultan, his face expressing great agony (belied, as it were, by his molding caress), helping a callypygean slave child to climb a column of onyx. Therewouldhavebeenthose 90 Lolita — Vladimir Nabokov luminous globules of gonadal glow that travel up the opalescent sides of juke boxes. Therewouldhavebeenallkindsofcampactivitiesonthepartoftheintermediategroup, Canoeing, Coranting, Combing Curls in the lakeside sun. Therewouldhavebeen poplars, apples, a suburban Sunday. Therewouldhavebeenafireopaldissolving within a ripple-ringed pool, a last throb, a last dab of color, stinging red, smearing pink, a sigh, a wincing child. 31 I am trying to describe these things not to relive them in my present boundless misery, but to sort out the portion of hell and the portion of heaven in that strange, awful, maddening world — nymphet love. Thebeastlyandbeautifulmergedatonepoint,andit is that borderline I would like to fix,andIfeelIfailtodosoutterly.Why? ThestipulationoftheRomanlaw,accordingtowhichagirlmaymarryattwelve,was adopted by the Church, and is still preserved, rather tacitly, in some of the United States. And fifteenislawfuleverywhere.Thereisnothingwrong,saybothhemispheres,when a brute of forty, blessed by the local priest and bloated with drink, sheds his sweat-drenched fineryandthrustshimselfuptothehiltintohisyouthfulbride.“Insuch stimulating temperate climates [says an old magazine in this prison library] as St. Louis, Chicago and Cincinnati, girls mature about the end of their twelfth year.” Dolores Haze was born less than three hundred miles from stimulating Cincinnati. I have but followed nature. I am nature’s faithful hound. Why then this horror that I cannot shake off?DidIdepriveherofherflower?Sensitivegentlewomenofthejury,I was not even her firstlover. 32 She told me the way she had been debauched. We ate flavorlessmealybananas,bruisedpeaches and very palatable potato chips, and die Kleine told me everything. Her voluble but disjointed account was accompanied by many a droll moue. As I think I have already observed, I especially remember one wry face on an “ugh!” basis: jelly-mouth distended sideways and eyes rolled up in a routine blend of comic disgust, resignation and tolerance for young frailty. Her astounding tale started with an introductory mention of her tent-mate of the previous summer, at another camp, a “very select” one as she put it. Thattent-mate(“quite a derelict character,” “half-crazy,” but a “swell kid”) instructed her in various manipulations. At first,loyalLorefusedtotellmehername. “Was it Grace Angel?” I asked. She shook her head. No, it wasn’t it was the daughter of a big shot. He — “Was it perhaps Rose Carmine?” Vladimir Nabokov — Lolita 91 “No, of course not. Her father —” “Was it, then, Agnes Sheridan perchance?” She swallowed and shook her head — and then did a double take. “Say, how come you know all those kids?” I explained. “Well,” she said. “Theyareprettybad,someofthatschoolbunch,butnotthatbad.If you have to know, her name was Elizabeth Talbot, she goes now to a swanky private school, her father is an executive.” I recalled with a funny pang the frequency with which poor Charlotte used to introduce into party chat such elegant tidbits as “when my daughter was out hiking last year with the Talbot girl.” I wanted to know if either mother learned of those sapphic diversions? “Gosh no,” exhaled limp Lo mimicking dread and relief, pressing a falsely fluttering hand to her chest. I was more interested, however, in heterosexual experience. She had entered the sixth grade at eleven, soon after moving to Ramsdale from the Middle West. What did she mean by “pretty bad”? Well, the Miranda twins had shared the same bed for years, and Donald Scott, who was the dumbest boy in the school, had done it with Hazel Smith in his uncle’s garage, and Kenneth Knight — who was the brightest — used to exhibit himself wherever and whenever he had a chance, and — “Let us switch to Camp Q,” I said. And presently I got the whole story. Barbara Burke, a sturdy blond, two years older than Lo and by far the camp’s best swimmer, had a very special canoe which she shared with Lo “because I was the only other girl who could make Willow Island” (some swimming test, I imagine). ThroughJuly,every morning — mark, reader, every blessed morning — Barbara and Lo would be helped to carry the boat to Onyx or Eryx (two small lakes in the wood) by Charlie Holmes, the camp mistress’ son, aged thirteen — and the only human male for a couple of miles around (excepting an old meek stone-deaf handyman, and a farmer in an old Ford who sometimes sold the campers eggs as farmers will); every morning, oh my reader, the three children would take a short cut through the beautiful innocent forest brimming with all the emblems of youth, dew, birdsongs, and at one point, among the luxuriant undergrowth, Lo would be left as sentinel, while Barbara and the boy copulated behind a bush. At first,Lohadrefused“totrywhatitwaslike,”butcuriosityandcamaraderieprevailed, and soon she and Barbara were doing it by turns with the silent, coarse and surly but indefatigable Charlie, who had as much sex appeal as a raw carrot but sported a fascinating collection of contraceptives which he used to fishoutofathirdnearby lake, a considerably larger and more populous one, called Lake Climax, after the booming young factory town of that name. Although conceding it was “sort of fun” and “fineforthecomplexion,”Lolita,Iamgladtosay,heldCharlie’smindandmanners in the greatest contempt. Nor had her temperament been roused by that filthyfiend.Infact,Ithinkhehadratherstunnedit,despitethe“fun.” 92 Lolita — Vladimir Nabokov By that time it was close to ten. With the ebb of lust, an ashen sense of awfulness, abetted by the realistic drabness of a gray neuralgic day, crept over me and hummed within my temples. Brown, naked, frail Lo, her narrow white buttocks to me, her sulky face to a door mirror, stood, arms akimbo, feet (in new slippers with pussy-fur tops) wide apart, and through a forehanging lock tritely mugged at herself in the glass. From the corridor came the cooing voices of colored maids at work, and presently there was a mild attempt to open the door of our room. I had Lo go to the bathroom and take a much-needed soap shower. Thebedwasafrightfulmesswithovertonesofpotatochips. She tried on a two-piece navy wool, then a sleeveless blouse with a swirly clathrate skirt, but the firstwastootightandthesecondtooample,andwhenIbeggedherto hurry up (the situation was beginning to frighten me), Lo viciously sent those nice presents of mine hurtling into a corner, and put on yesterday’s dress. When she was ready at last, I gave her a lovely new purse of simulated calf (in which I had slipped quite a few pennies and two mint-bright dimes) and told her to buy herself a magazine in the lobby. “I’ll be down in a minute,” I said. “And if I were you, my dear, I would not talk to strangers.” Except for my poor little gifts, there was not much to pack; but I was forced to devote a dangerous amount of time (was she up to something downstairs?) to arranging the bed in such a way as to suggest the abandoned nest of a restless father and his tomboy daughter, instead of an ex-convict’s saturnalia with a couple of fat old whores. ThenIfinisheddressingandhadthehoarybellboycomeupforthebags. Everything was fine.There,inthelobby,shesat,deepinanoverstuffedblood-redarmchair, deep in a lurid movie magazine. A fellow of my age in tweeds (the genre of the place had changed overnight to a spurious country-squire atmosphere) was staring at my Lolita over his dead cigar and stale newspaper. She wore her professional white socks and saddle oxfords, and that bright print frock with the square throat; a splash of jaded lamplight brought out the golden down on her warm brown limbs. Thereshe sat, her legs carelessly highcrossed, and her pale eyes skimming along the lines with every now and then a blink. Bill’s wife had worshipped him from afar long before they ever met: in fact, she used to secretly admire the famous young actor as he ate sundaes in Schwab’s drugstore. Nothing could have been more childish than her snubbed nose, freckled face or the purplish spot on her naked neck where a fairytale vampire had feasted, or the unconscious movement of her tongue exploring a touch of rosy rash around her swollen lips; nothing could be more harmless than to read about Jill, an energetic starlet who made her own clothes and was a student of serious literature; nothing could be more innocent than the part in that glossy brown hair with that silky sheen on the temple; nothing could be more naïve — But what sickening envy the lecherous fellow whoever he was — come to think of it, he resembled a little my Swiss uncle Gustave, also a great admirer of le découvert — would have experienced had he known that every nerve in me was still anointed and ringed with the feel of her body — the body of some immortal demon disguised as a female child. Vladimir Nabokov — Lolita 93 Was pink pig Mr. Swoon absolutely sure my wife had not telephoned? He was. If she did, would he tell her we had gone on to Aunt Clare’s place? He would, indeedie. I settled the bill and roused Lo from her chair. She read to the car. Still reading, she was driven to a so-called coffeeshopafewblockssouth.Oh,sheateallright.Sheevenlaid aside her magazine to eat, but a queer dullness had replaced her usual cheerfulness. I knew little Lo could be very nasty, so I braced myself and grinned, and waited for a squall. I was unbathed, unshaven, and had had no bowel movement. My nerves were a-jangle. I did not like the way my little mistress shrugged her shoulders and distended her nostrils when I attempted casual small talk. Had Phyllis been in the know before she joined her parents in Maine? I asked with a smile. “Look,” said Lo making a weeping grimace, “let us get offthesubject.”Ithentried—alsounsuccessfully,no matter how I smacked my lips — to interest her in the road map. Our destination was, let me remind my patient reader whose meek temper Lo ought to have copied, the gay town of Lepingville, somewhere near a hypothetical hospital. Thatdestination was in itself a perfectly arbitrary one (as, alas, so many were to be), and I shook in my shoes as I wondered how to keep the whole arrangement plausible, and what other plausible objectives to invent after we had taken in all the movies in Lepingville. More and more uncomfortable did Humbert Feel. It was something quite special, that feeling: an oppressive, hideous constraint as if I were sitting with the small ghost of somebody I had just killed. As she was in the act of getting back into the car, an expression of pain flittedacross Lo’s face. It flittedagain,moremeaningfully,asshesettleddownbesideme.No doubt, she reproduced it that second time for my benefit.Foolishly,Iaskedherwhat was the matter. “Nothing, you brute,” she replied. “You what?” I asked. She was silent. Leaving Briceland. Loquacious Lo was silent. Cold spiders of panic crawled down my back. Thiswasanorphan.Thiswasa lonechild,anabsolutewaif,withwhom a heavy-limbed, foul-smelling adult had had strenuous intercourse three times that very morning. Whether or not the realization of a lifelong dream had surpassed all expectation, it had, in a sense, overshot its mark — and plunged into a nightmare. I had been careless, stupid, and ignoble. And let me be quite frank: somewhere at the bottom of that dark turmoil I felt the writhing of desire again, so monstrous was my appetite for that miserable nymphet. Mingled with the pangs of guilt was the agonizing through that her mood might prevent me from making love to her again as soon as I found a nice country road where to park in peace. In other words, poor Humbert Humbert was dreadfully unhappy, and while steadily and inanely driving toward Lepingville, he kept racking his brains for some quip, under the bright wing of which he might dare turn to his seatmate. It was she, however, who broke the silence: “Oh, a squashed squirrel,” she said. “What a shame.” “Yes, isn’t it?” (eager, hopeful Hum). “Let us stop at the next gas station,” Lo continued. “I want to go to the washroom.” 94 Lolita — Vladimir Nabokov “We shall stop wherever you want,” I said. And then as a lovely, lonely, supercilious grove (oaks, I thought; American trees at that stage were beyond me) started to echo greenly the rush of our car, a red and ferny road on our right turned its head before slanting into the woodland, and I suggested we might perhaps — “Drive on,” my Lo cried shrilly. “Righto. Take it easy.” (Down, poor beast, down.) I glanced at her. ThankGod,thechildwassmiling. “You chump,” she said, sweetly smiling at me. “You revolting creature. I was a daisy-fresh girl, and look what you’ve done to me. I ought to call the police and tell them you raped me. Oh, you dirty, dirty old man.” Was she just joking? An ominous hysterical note rang through her silly words. Presently, making a sizzling sound with her lips, she started complaining of pains, said she could not sit, said I had torn something inside her. Thesweatrolleddownmyneck, and we almost ran over some little animal or other that was crossing the road with tail erect, and again my vile-tempered companion called me an ugly name. When we stopped at the fillingstation,shescrambledoutwithoutawordandwasalongtime away. Slowly, lovingly, an elderly friend with a broken nose wiped my windshield — they do it differentlyateveryplace,fromchamoisclothtosoapybrush,thisfellow used a pink sponge. She appeared at last. “Look,” she said in that neutral voice that hurt me so, “give me some dimes and nickels. I want to call mother in that hospital. What’s the number?” “Get in,” I said. “You can’t call that number.” “Why?” “Get in and slam the door.” She got in and slammed the door. Theoldgaragemanbeamedather.Iswungonto the highway. “Why can’t I call my mother if I want to?” “Because,” I answered, “your mother is dead.” 33 In the gay town of Lepingville I bought her four books of comics, a box of candy, a box of sanitary pads, two cokes, a manicure set, a travel clock with a luminous dial, a ring with a real topaz, a tennis racket, roller skates with white high shoes, fieldglasses,a portable radio set, chewing gum, a transparent raincoat, sunglasses, some more garments — swooners, shorts, all kinds of summer frocks. At the hotel we had separate rooms, but in the middle of the night she came sobbing into mine, and we made it up very gently. You see, she had absolutely nowhere else to go. Vladimir Nabokov — Lolita 95 Part Two 1 It was then that began our extensive travels all over the States. To any other type of tourist accommodation I soon grew to prefer the Functional Motel — clean, neat, safe nooks, ideal places for sleep, argument, reconciliation, insatiable illicit love. At first,inmydreadofarousingsuspicion,Iwouldeagerlypayforbothsectionsofonedouble unit, each containing a double bed. I wondered what type of foursome this arrangement was even intended for, since only a pharisaic parody of privacy could be attained by means of the incomplete partition dividing the cabin or room into two communicating love nests. By and by, the very possibilities that such honest promiscuity suggested (two young couples merrily swapping mates or a child shamming sleep to earwitness primal sonorities) made me bolder, and every now and then I would take a bed-and-cot or twin-bed cabin, a prison cell or paradise, with yellow window shades pulled down to create a morning illusion of Venice and sunshine when actually it was Pennsylvania and rain. We came to know — nous connûmes, to use a Flaubertian intonation — the stone cottages under enormous Chateaubriandesque trees, the brick unit, the adobe unit, the stucco court, on what the Tour Book of the Automobile Association describes as “shaded” or “spacious” or “landscaped” grounds. Thelogkind,finishedinknottypine, reminded Lo, by its golden-brown glaze, of friend-chicken bones. We held in contempt the plain whitewashed clapboard Kabins, with their faint sewerish smell or some other gloomy self-conscious stench and nothing to boast of (except “good beds”), and an unsmiling landlady always prepared to have her gift (“…well, I could give you…”) turned down. Nous connûmes (this is royal fun) the would-be enticements of their repetitious names — all those Sunset Motels, U-Beam Cottages, Hillcrest Courts, Pine View 96 Lolita — Vladimir Nabokov Courts, Mountain View Courts, Skyline Courts, Park Plaza Courts, Green Acres, Mac’s Courts. Therewassometimesaspeciallineinthewrite-up,suchas“Childrenwelcome, pets allowed” (You are welcome, you are allowed). Thebathsweremostlytiled showers, with an endless variety of spouting mechanisms, but with one definitelynon-Laodicean characteristic in common, a propensity, while in use, to turn instantly beastly hot or blindingly cold upon you, depending on whether your neighbor turned on his cold or his hot to deprive you of a necessary complement in the shower you had so carefully blended. Some motels had instructions pasted above the toilet (on whose tank the towels were unhygienically heaped) asking guests not to throw into its bowl garbage, beer cans, cartons, stillborn babies; others had special notices under glass, such as ThingstoDo(Riding:You will often see riders coming down Main Street on their way back from a romantic moonlight ride. “Often at 3 a.m.,” sneered unromantic Lo). Nous connûmes the various types of motor court operators, the reformed criminal, the retired teacher and the business flop,amongthemales;andthemotherly,pseudo-ladylike and madamic variants among the females. And sometimes trains would cry in the monstrously hot and humid night with heartrending and ominous plangency, mingling power and hysteria in one desperate scream. We avoided Tourist Homes, country cousins of Funeral ones, old-fashioned, genteel and showerless, with elaborate dressing tables in depressingly white-and-pink little bedrooms, and photographs of the landlady’s children in all their instars. But I did surrender, now and then, to Lo’s predilection for “real” hotels. She would pick out in the book, while I petted her in the parked car in the silence of a dusk-mellowed, mysterious side-road, some highly recommended lake lodge which offeredallsorts of things magnifiedbytheflashlightshemovedoverthem,suchascongenialcompany, between-meals snacks, outdoor barbecues — but which in my mind conjured up odious visions of stinking high school boys in sweatshirts and an ember-red cheek pressing against hers, while poor Dr. Humbert, embracing nothing but two masculine knees, would cold-humor his piles on the damp turf. Most empty to her, too, were those “Colonial” Inns, which apart from “gracious atmosphere” and picture windows, promised “unlimited quantities of M-m-m food.” Treasured recollections of my father’s palatial hotel sometimes led me to seek for its like in the strange country we traveled through. I was soon discouraged; but Lo kept following the scent of rich food ads, while I derived a not exclusively economic kick from such roadside signs as Timber Hotel, Children under 14 Free. On the other hand, I shudder when recalling that soi-disant “high-class” resort in a Midwestern state, which advertised “raid-the-icebox” midnight snacks and, intrigued by my accent, wanted to know my dead wife’s and dead mother’s maiden names. A two-days’ stay there cost me a hundred and twenty-four dollars! And do you remember, Miranda, that other “ultrasmart” robbers’ den with complimentary morning coffeeandcirculatingicewater,andnochildrenunder sixteen (no Lolitas, of course)? Immediately upon arrival at one of the plainer motor courts which became our habitual haunts, she would set the electric fan a-whirr, or induce me to drop a quarVladimir Nabokov — Lolita 97 ter into the radio, or she would read all the signs and inquire with a whine why she could not go riding up some advertised trail or swimming in that local pool of warm mineral water. Most often, in the slouching, bored way she cultivated, Lo would fall prostrate and abominably desirable into a red springchair or a green chaise longue, or a steamer chair of striped canvas with footrest and canopy, or a sling chair, or any other lawn chair under a garden umbrella on the patio, and it would take hours of blandishments, threats and promises to make her lend me for a few seconds her brown limbs in the seclusion of the five-dollarroombeforeundertakinganythingshemightprefer to my poor joy. A combination of naïveté and deception, of charm and vulgarity, of blue silks and rosy mirth, Lolita, when she chose, could be a most exasperating brat. I was not really quite prepared for her fitsofdisorganizedboredom,intenseandvehementgriping, her sprawling, droopy, dopey-eyed style, and what is called goofingoff— a kindof diffusedclowningwhichshethoughtwastoughinaboyishhoodlumway.Mentally, I found her to be a disgustingly conventional little girl. Sweet hot jazz, square dancing, gooey fudge sundaes, musicals, movie magazines and so forth — these were the obvious items in her list of beloved things. TheLordknowshowmanynickelsIfedto the gorgeous music boxes that came with every meal we had! I still hear the nasal voices of those invisibles serenading her, people with names like Sammy and Jo and Eddy and Tony and Peggy and Guy and Patty and Rex, and sentimental song hits, all of them as similar to my ear as her various candies were to my palate. She believed, with a kind of celestial trust, any advertisement or advice that that appeared in Movie Love or Screen Land — Starasil Starves Pimples, or “You better watch out if you’re wearing your shirttails outside your jeans, gals, because Jill says you shouldn’t.” If a roadside sign said: Visit Our Gift Shop — we had to visit it, had to buy its Indian curios, dolls, copper jewelry, cactus candy. Thewords“noveltiesandsouvenirs”simply entranced her by their trochaic lilt. If some café sign proclaimed Icecold Drinks, she was automatically stirred, although all drinks everywhere were ice-cold. She it was to whom ads were dedicated: the ideal consumer, the subject and object of every foul poster. And she attempted — unsuccessfully — to patronize only those restaurants where the holy spirit of Huncan Dines had descended upon the cute paper napkins and cottage-cheese-crested salads. In those days, neither she nor I had thought up yet the system of monetary bribes which was to work such havoc with my nerves and her morals somewhat later. I relied on three other methods to keep my pubescent concubine in submission and passable temper. A few years before, she had spent a rainy summer under Miss Phalen’s bleary eye in a dilapidated Appalachian farmhouse that had belonged to some gnarled Haze or other in the dead past. It still stood among its rank acres of golden rod on the edge of a flowerlessforest,attheendofapermanentlymuddyroad,twentymilesfromthe nearest hamlet. Lo recalled that scarecrow of a house, the solitude, the soggy old pastures, the wind, the bloated wilderness, with an energy of disgust that distorted her mouth and fattened her half-revealed tongue. And it was there that I warned her 98 Lolita — Vladimir Nabokov she would dwell with me in exile for months and years if need be, studying under me French and Latin, unless her “present attitude” changed. Charlotte, I began to understand you! A simple child, Lo would scream no! and frantically clutch at my driving hand whenever I put a stop to her tornadoes of temper by turning in the middle of a highway with the implication that I was about to take her straight to that dark and dismal abode. Thefarther,however,wetraveledawayfromitwest,thelesstangiblethatmenace became, and I had to adopt other methods of persuasion. Among these, the reformatory threat is the one I recall with the deepest moan of shame. From the very beginning of our concourse, I was clever enough to realize that I must secure her complete co-operation in keeping our relations secret, that it should become a second nature with her, no matter what grudge she might bear me, no matter what other pleasure she might seek. “Come and kiss your old man,” I would say, “and drop that moody nonsense. In former times, when I was still your dream male [the reader will notice what pains I took to speak Lo’s tongue], you swooned to records of the number one throb-and-sob idol of your coevals [Lo: “Of my what? Speak English”]. Thatidolofyourpalssounded, you thought, like friend Humbert. But now, I am just your old man, a dream dad protecting his dream daughter. “My chère Dolorès! I want to protect you, dear, from all the horrors that happen to little girls in coal sheds and alley ways, and alas, comme vous le savez trop bien, ma gentille, in the blueberry woods during the bluest of summers. ThroughthickandthinI will still stay your guardian, and if you are good, I hope a court may legalize that guardianship before long. Let us, however, forget, Dolores Haze, so-called legal terminology, terminology that accepts as rational the term ‘lewd and lascivious cohabitation.’ I am not a criminal sexual psychopath taking indecent liberties with a child. Therapist was Charlie Holmes; I am the therapist — a matter of nice spacing in the way of distinction. I am your daddum, Lo. Look, I’ve a learned book here about young girls. Look, darling, what it says. I quote: the normal girl — normal, mark you — the normal girl is usually extremely anxious to please her father. She feels in him the forerunner of the desired elusive male (‘elusive’ is good, by Polonius!). Thewisemother(andyourpoor mother would have been wise, had she lived) will encourage a companionship between father and daughter, realizing — excuse the corny style — that the girl forms her ideals of romance and of men from her association with her father. Now, what association does this cheery book mean — and recommend? I quote again: Among Sicilians sexual relations between a father and his daughter are accepted as a matter of course, and the girl who participates in such relationship is not looked upon with disapproval by the society of which she is part. I’m a great admirer of Sicilians, fineathletes, finemusicians,fineuprightpeople,Lo,andgreatlovers.Butlet’snotdigress.Only the other day we read in the newspapers some bunkum about a middle-aged morals offenderwhopleadedguiltytotheviolationoftheMannActandtotransporting a nine-year-old girl across state lines for immoral purposes, whatever these are. Vladimir Nabokov — Lolita 99 Dolores darling! You are not nine but almost thirteen, and I would not advise you to consider yourself my cross-country slave, and I deplore the Mann Act as lending itself to a dreadful pun, the revenge that the Gods of Semantics take against tight-zippered Philistines. I am your father, and I am speaking English, and I love you. “Finally, let us see what happens if you, a minor, accused of having impaired the morals of an adult in a respectable inn, what happens if you complain to the police of my having kidnapped and raped you? Let us suppose they believe you. A minor female, who allows a person over twenty-one to know her carnally, involves her victim into statutory rape, or second-degree sodomy, depending on the technique; and the maximum penalty is ten years. So, I go to jail. Okay. I go to jail. But what happens to you, my orphan? Well, you are luckier. You become the ward of the Department of Public Welfare — which I am afraid sounds a little bleak. A nice grim matron of the Miss Phalen type, but more rigid and not a drinking woman, will take away your lipstick and fancy clothes. No more gadding about! I don’t know if you have ever heard of the laws relating to dependent, neglected, incorrigible and delinquent children. While I stand gripping the bars, you, happy neglected child, will be given a choice of various dwelling places, all more or less the same, the correctional school, the reformatory, the juvenile detention home, or one of those admirable girls’ protectories where you knit things, and sing hymns, and have rancid pancakes on Sundays. You will go there, Lolita — my Lolita, this Lolita will leave plainer words, if we two are found out, you will be analyzed and institutionalized, my pet, c’est tout. You will dwell, my Lolita will dwell (come here, my brown flower)withthirty-nineotherdopesinadirtydormitory(no, allow me, please) under the supervision of hideous matrons. Thisisthesituation,this is the choice. Don’t you think that under the circumstances Dolores Haze had better stick to her old man?” By rubbing all this in, I succeeded in terrorizing Lo, who despite a certain brash alertness of manner and spurts of wit was not as intelligent a child as her I.Q. might suggest. But if I managed to establish that background of shared secrecy and shared guilt, I was much less successful in keeping her in good humor. Every morning during our yearlong travels I had to devise some expectation, some special point in space and time for her to look forward to, for her to survive till bedtime. Otherwise, deprived of a shaping and sustaining purpose, the skeleton of her day sagged and collapsed. Theobjectinviewmightbeanything—alighthouseinVirginia,anaturalcaveinArkansas converted to a café, a collection of guns and violins somewhere in Oklahoma, a replica of the Grotto of Lourdes in Louisiana, shabby photographs of the bonanza mining period in the local museum of a Rocky Mountains resort, anything whatsoever — but it had to be there, in front of us, like a fixedstar,althoughaslikelyasnotLo would feign gagging as soon as we got to it. By putting the geography of the United States into motion, I did my best for hours on end to give her the impression of “going places,” of rolling on to some definite destination, to some unusual delight. I have never seen such smooth amiable roads as those that now radiated before us, across the crazy quilt of forty-eight states. 100 Lolita — Vladimir Nabokov Voraciously we consumed those long highways, in rapt silence we glided over their glossy black dance floors.NotonlyhadLonoeyeforscenerybutshefuriouslyresented my calling her attention to this or that enchanting detail of landscape; which I myself learned to discern only after being exposed for quite a time to the delicate beauty ever present in the margin of our undeserving journey. By a paradox of pictorial thought, the average lowland North-American countryside had at firstseemedto me something I accepted with a shock of amused recognition because of those painted oilcloths which were imported from America in the old days to be hung above washstands in Central-European nurseries, and which fascinated a drowsy child at bed time with the rustic green views they depicted — opaque curly trees, a barn, cattle, a brook, the dull white of vague orchards in bloom, and perhaps a stone fence or hills of greenish gouache. But gradually the models of those elementary rusticities became stranger and stranger to the eye, the nearer I came to know them. Beyond the tilled plain, beyond the toy roofs, there would be a slow suffusionofinutileloveliness,alowsun in a platinum haze with a warm, peeled-peach tinge pervading the upper edge of a two-dimensional, dove-gray cloud fusing with the distant amorous mist. Theremight be a line of spaced trees silhouetted against the horizon, and hot still noons above a wilderness of clover, and Claude Lorrain clouds inscribed remotely into misty azure with only their cumulus part conspicuous against the neutral swoon of the background. Or again, it might be a stern El Greco horizon, pregnant with inky rain, and a passing glimpse of some mummy-necked farmer, and all around alternating strips of quick-silverish water and harsh green corn, the whole arrangement opening like a fan, somewhere in Kansas. Now and then, in the vastness of those plains, huge trees would advance toward us to cluster self-consciously by the roadside and provide a bit of humanitarian shade above a picnic table, with sun flecks,flattenedpapercups,samarasanddiscardedice-cream sticks littering the brown ground. A great user of roadside facilities, my unfastidious Lo would be charmed by toilet signs — Guys-Gals, John-Jane, Jack-Jill and even Buck’s-Doe’s; while lost in an artist’s dream, I would stare at the honest brightness of the gasoline paraphernalia against the splendid green of oaks, or at a distant hill scrambling out — scarred but still untamed — from the wilderness of agriculture that was trying to swallow it. At night, tall trucks studded with colored lights, like dreadful giant Christmas trees, loomed in the darkness and thundered by the belated little sedan. And again next day a thinly populated sky, losing its blue to the heat, would melt overhead, and Lo would clamor for a drink, and her cheeks would hollow vigorously over the straw, and the car inside would be a furnace when we got in again, and the road shimmered ahead, with a remote car changing its shape mirage-like in the surface glare, and seeming to hang for a moment, old-fashionedly square and high, in the hot haze. And as we pushed westward, patches of what the garage-man called “sage brush” appeared, and then the mysterious outlines of table-like hills, and then red bluffsink-blottedwith junipers, and then a mountain range, dun grading into blue, and blue into dream, Vladimir Nabokov — Lolita 101 and the desert would meet us with a steady gale, dust, gray thorn bushes, and hideous bits of tissue paper mimicking pale flowersamongthepricklesofwind-torturedwithered stalks all along the highway; in the middle o which there sometimes stood simple cows, immobilized in a position (tail left, white eyelashes right) cutting across all human rules of traffic. My lawyer has suggested I give a clear, frank account of the itinerary we followed, and I suppose I have reached here a point where I cannot avoid that chore. Roughly, during that mad year (August ?947 to August ?948), our route began with a series of wiggles and whorls in New England, then meandered south, up and down, east and west; dipped deep into ce qu’on appelle Dixieland, avoided Florida because the Farlows were there, veered west, zigzagged through corn belts and cotton belts (this is not too clear I am afraid, Clarence, but I did not keep any notes, and have at my disposal only an atrociously crippled tour book in three volumes, almost a symbol of my torn and tattered past, in which to check these recollections); crossed and recrossed the Rockies, straggled through southern deserts where we wintered; reached the Pacific,turnednorth through the pale lilac fluffoffloweringshrubsalongforestroads;almostreachedthe Canadian border; and proceeded east, across good lands and bad lands, back to agriculture on a grand scale, avoiding, despite little Lo’s strident remonstrations, little Lo’s birthplace, in a corn, coal and hog producing area; and finallyreturnedtothefoldof the East, petering out in the college town of Beardsley. 2 Now, in perusing what follows, the reader should bear in mind not only the general circuit as adumbrated above, with its many sidetrips and tourist traps, secondary circles and skittish deviations, but also the fact that far from being an indolent partie de plaisir, our tour was a hard, twisted, teleological growth, whose sole raison d’être (these French clichés are symptomatic) was to keep my companion in passable humor from kiss to kiss. Thumbingthroughthatbatteredtourbook,IdimlyevokethatMagnoliaGarden in a southern state which cost me four bucks and which, according to the ad in the book, you must visit for three reasons: because John Galsworthy (a stone-dead writer of sorts) acclaimed it as the world’s fairest garden; because in ?900 Baedeker’s Guide had marked it with a star; and finally,because…O,Reader,MyReader,guess!…because children (and by Jingo was not my Lolita a child!) will “walk starry-eyed and reverently through this foretaste of Heaven, drinking in beauty that can influencea life.” “Not mine,” said grim Lo, and settled down on a bench with the fillingsoftwoSunday papers in her lovely lap. We passed and re-passed through the whole gamut of American roadside restaurants, from the lowly Eat with its deer head (dark trace of long tear at inner canthus), “humorous” picture post cards of the posterior “Kurort” type, impaled guest checks, life 102 Lolita — Vladimir Nabokov savers, sunglasses, adman visions of celestial sundaes, one half of a chocolate cake under glass, and several horribly experienced flieszigzaggingoverthestickysugar-pouron the ignoble counter; and all the way to the expensive place with the subdued lights, preposterously poor table linen, inept waiters (ex-convicts or college boys), the roan back of a screen actress, the sable eyebrows of her male of the moment, and an orchestra of zoot-suiters with trumpets. We inspected the world’s largest stalagmite in a cave where three southeastern states have a family reunion; admission by age; adults one dollar, pubescents sixty cents. A granite obelisk commemorating the Battle of Blue Licks, with old bones and Indian pottery in the museum nearby, Lo a dime, very reasonable. Thepresentlogcabinboldly simulating the past log cabin where Lincoln was born. A boulder, with a plaque, in memory of the author of “Trees” (by now we are in Poplar Cove, N.C., reached by what my kind, tolerant, usually so restrained tour book angrily calls “a very narrow road, poorly maintained,” to which, though no Kilmerite, I subscribe). From a hired motor-boat operated by an elderly, but still repulsively handsome White Russian, a baron they said (Lo’s palms were damp, the little fool), who had known in California good old Maximovich and Valeria, we could distinguish the inaccessible “millionaires’ colony” on an island, somewhere offtheGeorgiacoast.Weinspectedfurther:a collection of European hotel picture post cards in a museum devoted to hobbies at a Mississippi resort, where with a hot wave of pride I discovered a colored photo of my father’s Mirana, its striped awnings, its flagflyingabovetheretouchedpalmtrees.“Sowhat?” said Lo, squinting at the bronzed owner of an expensive car who had followed us into the Hobby House. Relics of the cotton era. A forest in Arkansas and, on her brown shoulder, a raised purple-pink swelling (the work of some gnat) which I eased of its beautiful transparent poison between my long thumbnails and then sucked till I was gorged on her spicy blood. Bourbon Street (in a town named New Orleans) whose sidewalks, said the tour book, “may [I liked the “may”] feature entertainment by pickaninnies who will {I liked the “will” even better] tap-dance for pennies” (what fun), while “its numerous small and intimate night clubs are thronged with visitors” (naughty). Collections of frontier lore. Ante-bellum homes with iron-trellis balconies and hand-worked stairs, the kind down which movie ladies with sun-kissed shoulders run in rich Technicolor, holding up the fronts of their flouncedskirtswithbothlittle hands in that special way, and the devoted Negress shaking her head on the upper landing. TheMenningerFoundation,apsychiatricclinic,justfortheheckofit.A patch of beautifully eroded clay; and yucca blossoms, so pure, so waxy, but lousy with creeping white flies.Independence,Missouri,thestartingpointoftheOldOregon Trail; and Abilene, Kansas, the home of the Wild Bill Something Rodeo. Distant mountains. Near mountains. More mountains; bluish beauties never attainable, or ever turning into inhabited hill after hill; south-eastern ranges, altitudinal failures as alps go; heart and sky-piercing snow-veined gray colossi of stone, relentless peaks appearing from nowhere at a turn of the highway; timbered enormities, with a system of neatly overlapping dark firs,interruptedinplacesbypalepuffsofaspen;pink Vladimir Nabokov — Lolita 103 and lilac formations, Pharaonic, phallic, “too prehistoric for words” (blasé Lo); buttes of black lava; early spring mountains with young-elephant lanugo along their spines; end-of-the-summer mountains, all hunched up, their heavy Egyptian limbs folded under folds of tawny moth-eaten plush; oatmeal hills, fleckedwithgreenroundoaks;a last rufous mountain with a rich rug of lucerne at its foot. Moreover, we inspected: Little Iceberg Lake, somewhere in Colorado, and the snow banks, and the cushionets of tiny alpine flowers,andmoresnow;downwhichLoinred-peaked cap tried to slide, and squealed, and was snowballed by some youngsters, and retaliated in kind comme on dit. Skeletons of burned aspens, patches of spired blue flowers.Thevariousitemsofa scenicdrive.Hundredsofscenicdrives,thousandsofBear Creeks, Soda Springs, Painted Canyons. Texas, a drought-struck plain. Crystal Chamber in the longest cave in the world, children under ?2 free, Lo a young captive. A collection of a local lady’s homemade sculptures, closed on a miserable Monday morning, dust, wind, witherland. Conception Park, in a town on the Mexican border which I dared not cross. Thereandelsewhere,hundredsofgrayhummingbirdsin the dusk, probing the throats of dim flowers.Shakespeare,aghosttowninNewMexico, where bad man Russian Bill was colorfully hanged seventy years ago. Fish hatcheries. Cliffdwellings.Themummyofa child(FlorentineBea’sIndiancontemporary). Our twentieth Hell’s Canyon. Our fiftiethGatewaytosomethingorotherfide that tour book, the cover of which had been lost by that time. A tick in my groin. Always the same three old men, in hats and suspenders, idling away the summer afternoon under the trees near the public fountain. A hazy blue view beyond railings on a mountain pass, and the backs of a family enjoying it (with Lo, in a hot, happy, wild, intense, hopeful, hopeless whisper — “Look, the McCrystals, please, let’s talk to them, please” — let’s talk to them, reader! — “please! I’ll do anything you want, oh, please…”). Indian ceremonial dances, strictly commercial. ART: American Refrigerator Transit Company. Obvious Arizona, pueblo dwellings, aboriginal pictographs, a dinosaur track in a desert canyon, printed there thirty million years ago, when I was a child. A lanky, six-foot, pale boy with an active Adam’s apple, ogling Lo and her orange-brown bare midriff,whichIkissedfiveminuteslater,Jack.Winterinthedesert,springinthefoothills, almonds in bloom. Reno, a dreary town in Nevada, with a nightlife said to be “cosmopolitan and mature.” A winery in California, with a church built in the shape of a wine barrel. Death Valley. Scotty’s Castle. Works of Art collected by one Rogers over a period of years. Theuglyvillasofhandsomeactresses.R.L.Stevenson’sfootprintonan extinct volcano. Mission Dolores: good title for book. Surf-carved sandstone festoons. A man having a lavish epileptic fitonthegroundinRussianGulchStatePark.Blue, blue Crater Lake. A fishhatcheryinIdahoandtheStatePenitentiary.SomberYellowstone Park and its colored hot springs, baby geysers, rainbows of bubbling mud-symbols of my passion. A herd of antelopes in a wildlife refuge. Our hundredth cavern, adults one dollar, Lolita fiftycents.AchateaubuiltbyaFrenchmarquessinN.D.TheCornPalaceinS.D.;andthehugeheadsofpresidentscarvedintoweringgranite.TheBeardedWomanreadourjingleandnowsheisnolongersingle.AzooinIndi104 Lolita — Vladimir Nabokov ana where a large troop of monkeys lived on concrete replica of Christopher Columbus’ flagship.Billionsofdead,orhalfdead,fish-smellingMayfliesin everywindowof every eating place all along a dreary sandy shore. Fat gulls on big stones as seen from the ferry City of Cheboygan, whose brown woolly smoke arched and dipped over the green shadow it cast on the aquamarine lake. A motel whose ventilator pipe passed under the city sewer. Lincoln’s home, largely spurious, with parlor books and period furniture that most visitors reverently accepted as personal belongings. We had rows, minor and major. Thebiggestoneswehadtookplace:atLaceworkCabins, Virginia; on Park Avenue, Little Rock, near a school; on Milner Pass, ?0,759 feet high, in Colorado; at the corner of Seventh Street and Central Avenue in Phoenix, Arizona; on ThirdStreet,LosAngeles,becausetheticketstosomestudioorotherwere sold out; at a motel called Poplar Shade in Utah, where six pubescent trees were scarcely taller than my Lolita, and where she asked, à propos de rien, how long did I think we were going to live in stuffycabins,doingfilthythingstogetherandneverbehaving like ordinary people? On N. Broadway, Burns, Oregon, corner of W. Washington, facing Safeway, a grocery. In some little town in the Sun Valley of Idaho, before a brick hotel, pale and flushedbricksnicelymixed,with,opposite,apoplarplayingits liquid shadows all over the local Honor Roll. In a sage brush wilderness, between Pinedale and Farson. Somewhere in Nebraska, on Main Street, near the First National Bank, established ?889, with a view of a railway crossing in the vista of the street, and beyond that the white organ pipes of a multiple silo. And on McEwen St., corner of Wheaton Ave., in a Michigan town bearing his firstname. We came to know the curious roadside species, Hitchhiking Man, Homo pollex of science, with all its many sub-species and forms; the modest soldier, spic and span, quietly waiting, quietly conscious of khaki’s viatic appeal; the schoolboy wishing to go two blocks; the killer wishing to go two thousand miles; the mysterious, nervous, elderly gent, with brand-new suitcase and clipped mustache; a trio of optimistic Mexicans; the college student displaying the grime of vacational outdoor work as proudly as the name of the famous college arching across the front of his sweatshirt; the desperate lady whose battery has just died on her; the clean-cut, glossy-haired, shifty-eyed, white-faced young beasts in loud shirts and coats, vigorously, almost priapically thrusting out tense thumbs to tempt lone women or sadsack salesmen with fancy cravings. “Let’s take him,” Lo would often plead, rubbing her knees together in a way she had, as some particularly disgusting pollex, some man of my age and shoulder breadth, with the face à claques of unemployed actor, walked backwards, practically in the path of our car. Oh, I had to keep a very sharp eye on Lo, little limp Lo! Owing perhaps to constant amorous exercise, she radiated, despite her very childish appearance, some special languorous glow which threw garage fellows, hotel pages, vacationists, goons in luxurious cars, maroon morons near blued pools, into fitsofconcupiscencewhichmight have tickled my pride, had it not incensed my jealousy. For little Lo was aware Vladimir Nabokov — Lolita 105 of that glow of hers, and I would often catch her coulant un regard in the direction of some amiable male, some grease monkey, with a sinewy golden-brown forearm and watch-braceleted wrist, and hardly had I turned my back to go and buy this very Lo a lollipop, than I would hear her and the fair mechanic burst into a perfect love song of wisecracks. When, during our longer stops, I would relax after a particularly violent morning in bed, and out of the goodness of my lulled heart allow her — indulgent Hum! — to visit the rose garden or children’s library across the street with a motor court neighbor’s plain little Mary and Mary’s eight-year-old brother, Lo would come back an hour late, with barefoot Mary trailing far behind, and the little boy metamorphosed into two gangling, golden-haired high school uglies, all muscles and gonorrhea. ThereadermaywellimaginewhatIansweredmypetwhen—ratheruncertainly,I admit — she would ask me if she could go with Carl and Al here to the roller-skating rink. I remember the firsttime,adustywindyafternoon,Ididlethergotoonesuchrink. Cruelly she said it would be no fun if I accompanied her, since that time of day was reserved for teenagers. We wrangled out a compromise: I remained in the car, among other (empty) cars with their noses to the canvas-topped open-air rink, where some fiftyyoungpeople,manyinpairs,wereendlesslyrollingroundandroundtomechanical music, and the wind silvered the trees. Dolly wore blue jeans and white high shoes, as most of the other girls did. I kept counting the revolutions of the rolling crowd — and suddenly she was missing. When she rolled past again, she was together with three hoodlums whom I had heard analyze a moment before the girl skaters from the outside — and jeer at a lovely leggy young thing who had arrived clad in red shorts instead of those jeans and slacks. At inspection stations on highways entering Arizona or California, a policeman’s cousin would peer with such intensity at us that my poor heart wobbled. “Any honey?” he would inquire, and every time my sweet fool giggled. I still have, vibrating all along my optic nerve, visions of Lo on horseback, a link in the chain of a guided trip along a bridle trail: Lo bobbing at a walking pace, with an old woman rider in front and a lecherous red-necked dude-rancher behind; and I behind him, hating his fat flowery-shirted back even more fervently than a motorist does a slow truck on a mountain road. Or else, at a ski lodge, I would see her floatingawayfromme,celestialandsolitary, in an ethereal chairlift, up and up, to a glittering summit where laughing athletes stripped to the waist were waiting for her, for her. In whatever town we stopped I would inquire, in my polite European way, anent the whereabouts of natatoriums, museums, local schools, the number of children in the nearest school and so forth; and at school bus time, smiling and twitching a little (I discovered this tic nerveux because cruel Lo was the firsttomimicit),Iwouldparkat a strategic point, with my vagrant schoolgirl beside me in the car, to watch the children leave school — always a pretty sight. Thissortofthingsoonbegantoboremysoeasily bored Lolita, and, having a childish lack of sympathy for other people’s whims, 106 Lolita — Vladimir Nabokov she would insult me and my desire to have her caress me while blue-eyed little brunettes in blue shorts, copperheads in green boleros, and blurred boyish blondes in faded slacks passed by in the sun. As a sort of compromise, I freely advocated whenever and wherever possible the use of swimming pools with other girl-children. She adored brilliant water and was a remarkably smart diver. Comfortably robed, I would settle down in the rich post-meridian shade after my own demure dip, and there I would sit, with a dummy book or a bag of bonbons, or both, or nothing but my tingling glands, and watch her gambol, rubber-capped, bepearled, smoothly tanned, as glad as an ad, in her trim-fitted satin pants and shirred bra. Pubescent sweetheart! How smugly would I marvel that she was mine, mine, mine, and revise the recent matitudinal swoon to the moan of the mourning doves, and devise the late afternoon one, and slitting my sun-speared eyes, compare Lolita to whatever other nymphets parsimonious chance collected around her for my anthological delectation and judgment; and today, putting my hand on my ailing heart, I really do not think that any of them ever surpassed her in desirability, or if they did, it was so two or three times at the most, in a certain light, with certain perfumes blended in the air — once in the hopeless case of a pale Spanish child, the daughter of a heavy-jawed nobleman, and another time — mais je divague. Naturally, I had to be always wary, fully realizing, in my lucid jealousy, the danger of those dazzling romps. I had only to turn away for a moment — to walk, say, a few steps in order to see if our cabin was at last ready after the morning change of linen — and Lo and Behold, upon returning, I would findtheformer, les yeux perdus, dipping and kicking her long-toed feet in the water on the stone edge of which she lolled, while, on either side of her, there crouched a brun adolescent whom her russet beauty and the quicksilver in the baby folds of her stomach were sure to cause to se tordre — oh Baudelaire! — in recurrent dreams for months to come. I tried to teach her to play tennis so we might have more amusements in common; but although I had been a good player in my prime, I proved to be hopeless as a teacher; and so, in California, I got her to take a number of very expensive lessons with a famous coach, a husky, wrinkled old-timer, with a harem of ball boys; he looked an awful wreck offthecourt,butnowandthen,when,inthecourseofalesson,tokeepup the exchange, he would put out as it were an exquisite spring blossom of a stroke and twang the ball back to his pupil, that divine delicacy of absolute power made me recall that, thirty years before, I had seen him in Cannes demolish the great Gobbert! Until she began taking those lessons, I thought she would never learn the game. On this or that hotel court I would drill Lo, and try to relive the days when in a hot gale, a daze of dust, and queer lassitude, I fed ball after ball to gay, innocent, elegant Annabel (gleam of bracelet, pleated white skirt, black velvet hair band). With every word of persistent advice I would only augment Lo’s sullen fury. To our games, oddly enough, she preferred — at least, before we reached California — formless pat ball approximations — more ball hunting than actual play — with a wispy, weak, wonderfully pretty in an ange gauche way coeval. A helpful spectator, I would go up to that other child, Vladimir Nabokov — Lolita 107 and inhale her faint musky fragrance as I touched her forearm and held her knobby wrist, and push this way or that her cool thigh to show her the back-hand stance. In the meantime, Lo, bending forward, would let her sunny-brown curls hang forward as she stuck her racket, like a cripple’s stick, into the ground and emitted a tremendous ugh of disgust at my intrusion. I would leave them to their game and look on, comparing their bodies in motion, a silk scarf round my throat; this was in south Arizona, I think — and the days had a lazy lining warmth, and awkward Lo would slash at the ball and miss it, and curse, and send a simulacrum of a serve into the net, and show the wet glistening young down of her armpit as she brandished her racket in despair, and her even more insipid partner would dutifully rush out after every ball, and retrieve none; but both were enjoying themselves beautifully, and in clear ringing tones kept the exact score of their ineptitudes all the time. One day, I remember, I offeredtobringthemcolddrinksfromthehotel,andwentup the gravel path, and came back with two tall glasses of pineapple juice, soda and ice; and then a sudden void within my chest made me stop as I saw that the tennis court was deserted. I stooped to set down the glasses on a bench and for some reason, with a kind of icy vividness, saw Charlotte’s face in death, and I glanced around, and noticed Lo in white shorts receding through the speckled shadow of a garden path in the company of a tall man who carried two tennis rackets. I sprang after them, but as I was crashing through the shrubbery, I saw, in an alternate vision, as if life’s course constantly branched, Lo, in slacks, and her companion, in shorts, trudging up and down a small weedy area, and beating bushes with their rackets in listless search for their last lost ball. I itemize these sunny nothings mainly to prove to my judges that I did everything in my power to give my Lolita a really good time. How charming it was to see her, a child herself, showing another child some of her few accomplishments, such as for example a special way of jumping rope. With her right hand holding her left arm behind her untanned back, the lesser nymphet, a diaphanous darling, would be all eyes, as the pavonine sun was all eyes on the gravel under the floweringtrees,whilein the midst of that oculate paradise, my freckled and raffishlassskipped,repeating the movements of so many others I had gloated over on the sun-shot, watered, damp-smelling sidewalks and ramparts of ancient Europe. Presently, she would hand the rope back to her little Spanish friend, and watch in her turn the repeated lesson, and brush away the hair from her brow, and fold her arms, and step on one toe with the other, or drop her hands loosely upon her still unflaredhips,andIwouldsatisfymyself that the damned staffhadatlastfinishedcleaningupourcottage;whereupon,flashingasmiletotheshy,dark-hairedpagegirlofmyprincessandthrustingmyfatherly fingersdeepintoLo’shairfrombehind,andthengentlybutfirmlyclaspingthem around the nape of her neck, I would lead my reluctant pet to our small home for a quick connection before dinner. “Whose cat has scratched poor you?” A full-blown fleshyhandsomewomanoftherepulsive type to which I was particularly attractive might ask me at the “lodge,” during 108 Lolita — Vladimir Nabokov a table d’hôte dinner followed by dancing promised to Lo. Thiswasoneofthereasonswhy I tried to keep as far away from people as possible, while Lo, on the other hand, would do her utmost to draw as many potential witnesses into her orbit as she could. She would be, figurativelyspeakingwagginghertinytail,herwholebehindinfact as little bitches do — while some grinning stranger accosted us and began a bright conversation with a comparative study of license plates. “Long way from home!” Inquisitive parents, in order to pump Lo about me, would suggest her going to a movie with their children. We had some close shaves. Thewaterfallnuisancepursuedmeofcourse in all our caravansaries. But I never realized how wafery their wall substance was until one evening, after I had loved too loudly, a neighbor’s masculine cough filledthepauseasclearlyasminewouldhavedone;andnextmorningasIwashaving breakfast at the milk bar (Lo was a late sleeper, and I liked to bring her a pot of hot coffeeinbed),myneighboroftheeve,anelderlyfoolwearingplainglassesonhis long virtuous nose and a convention badge on his lapel, somehow managed to rig up a conversation with me, in the course of which he inquired, if my missus was like his missus a rather reluctant get-upper when not on the farm; and had not the hideous danger I was skirting almost suffocatedme,Imighthaveenjoyedtheoddlookof surprise on his thin-lipped weather-beaten face when I drily answered, as I slithered offmystool,thatIwasthankGodawidower. How sweet it was to bring that coffeetoher,andthendenyituntilshehaddoneher morning duty. And I was such a thoughtful friend, such a passionate father, such a good pediatrician, attending to all the wants of my little auburn brunette’s body! My only grudge against nature was that I could not turn my Lolita inside out and apply voracious lips to her young matrix, her unknown heart, her nacreous liver, the sea-grapes of her lungs, her comely twin kidneys. On especially tropical afternoons, in the sticky closeness of the siesta, I liked the cool feel of armchair leather against my massive nakedness as I held her in my lap. Thereshewouldbe,atypicalkidpickingher nose while engrossed in the lighter sections of a newspaper, as indifferenttomyecstasy as if it were something she had sat upon, a shoe, a doll, the handle of a tennis racket, and was too indolent to remove. Her eyes would follow the adventures of her favorite strip characters: there was one well-drawn sloppy bobby-soxer, with high cheekbones and angular gestures, that I was not above enjoying myself; she studied the photographic results of head-on collisions; she never doubted the reality of place, time, and circumstance alleged to match the publicity pictures of naked-thighed beauties; and she was curiously fascinated by the photographs of local brides, some in full wedding apparel, holding bouquets and wearing glasses. A flywouldsettleandwalkinthevicinityofhernavelorexplorehertenderpaleareolas. She tried to catch it in her fist(Charlotte’smethod)andthenwouldturntothe column Let’s Explore Your Mind. “Let’s explore your mind. Would sex crimes be reduced if children obeyed a few don’ts? Don’t play around public toilets. Don’t take candy or rides from strangers. If picked up, mark down the license of the car.” Vladimir Nabokov — Lolita 109 “…and the brand of the candy,” I volunteered. She went on, her cheek (recedent) against mine (pursuant); and this was a good day, mark, O reader! “If you don’t have a pencil, but are old enough to read —” “We,” I quip-quoted, “medieval mariners, have placed in this bottle —” “If,” she repeated, “you don’t have a pencil, but are old enough to read and write — this is what the guy means, isn’t it, you dope — scratch the number somehow on the roadside.” “With your little claws, Lolita.” 3 She had entered my world, umber and black Humberland, with rash curiosity; she surveyed it with a shrug of amused distaste; and it seemed to me now that she was ready to turn away from it with something akin to plain repulsion. Never did she vibrate under my touch, and a strident “what d’you think you are doing?” was all I got for my pains. To the wonderland I had to offer,myfoolpreferredthecorniestmovies, the most cloying fudge. To think that between a Hamburger and a Humburger, she would — invariably, with icy precision — plump for the former. Thereisnothingmore atrociously cruel than an adored child. Did I mention the name of that milk bar I visited a moment ago? It was, of all things, TheFrigidQueen.Smilingalittlesadly,I dubbed her My Frigid Princess. She did not see the wistful joke. Oh, do not scowl at me, reader, I do not intend to convey the impression that I did not manage to be happy. Reader must understand that in the possession and thralldom of a nymphet the enchanted traveler stands, as it were, beyond happiness. For there is no other bliss on earth comparable to that of fondling a nymphet. It is hors concours, that bliss, it belongs to another class, another plane of sensitivity. Despite our tiffs,despite her nastiness, despite all the fuss and faces she made, and the vulgarity, and the danger, and the horrible hopelessness of it all, I still dwelled deep in my elected paradise — a paradise whose skies were the color of hell-flames—butstillaparadise. Theablepsychiatristwhostudiesmycase—andwhombynowDr.Humberthasplunged, I trust, into a state of leporine fascination — is no doubt anxious to have me take Lolita to the seaside and have me findthere,atlast,the“gratification”ofa lifetime urge, and release from the “subconscious” obsession of an incomplete childhood romance with the initial little Miss Lee. Well, comrade, let me tell you that I did look for a beach, though I also have to confess that by the time we reached its mirage of gray water, so many delights had already been granted me by my traveling companion that the search for a Kingdom by the Sea, a Sublimated Riviera, or whatnot, far from being the impulse of the subconscious, had become the rational pursuit of a purely theoretical thrill. Theangelsknewit, and arranged things accordingly. A visit to a plausible cove on the Atlantic side was 110 Lolita — Vladimir Nabokov completely messed up by foul weather. A thick damp sky, muddy waves, a sense of boundless but somehow matter-of-fact mist — what could be further removed from the crisp charm, the sapphire occasion and rosy contingency of my Riviera romance? A couple of semitropical beaches on the Gulf, though bright enough, were starred and spattered by venomous beasties and swept by hurricane winds. Finally, on a Californian beach, facing the phantom of the Pacific,Ihituponsomeratherperverseprivacy in a kind of cave whence you could hear the shrikes of a lot of girl scouts taking their firstsurfbathonaseparatepartofthebeach,behindrottingtrees;butthefogwas like a wet blanket, and the sand was gritty and clammy, and Lo was all goosefleshand grit, and for the firsttimeinmylifeIhadaslittledesireforherasforamanatee.Perhaps, my learned readers may perk up if I tell them that even had we discovered a piece of sympathetic seaside somewhere, it would have come too late, since my real liberation had occurred much earlier: at the moment, in point of fact, when Annabel Haze, alias Dolores Lee, alias Loleeta, had appeared tome, golden and brown, kneeling, looking up, on that shoddy veranda, in a kind of fictitious,dishonest,buteminentlysatisfactory seaside arrangement (although there was nothing but a second-rate lake in the neighborhood.). So much for those special sensations, influence,ifnotactuallybroughtabout,bythe tenets of modern psychiatry. Consequently, I turned away — I headed my Lolita away — from beaches which were either too bleak when lone, or too populous when ablaze. However, in recollection, I suppose, of my hopeless hauntings of public parks in Europe, I was still keenly interested in outdoor activities and desirous of findingsuitable playgrounds in the open where I had sufferedsuchshamefulprivations.Here,too, I was to be thwarted. ThedisappointmentImustnowregister(asIgentlygrademy story into an expression of the continuous risk and dread that ran through my bliss) should in no wise reflectonthelyrical,epic,tragicbutneverArcadianAmerican wilds. Theyarebeautiful,heart-rendinglybeautiful,thosewilds,withaqualityofwide-eyed, unsung, innocent surrender that my lacquered, toy-bright Swiss villages and exhaustively lauded Alps no longer possess. Innumerable lovers have clipped and kissed on the trim turf of old-would mountainsides, on the innerspring moss, by a handy, hygienic rill, on rustic benches under the initialed oaks, and in so many cabanes in so many beech forests. But in the Wilds of America the open-air lover will not finditeasytoindulgeinthemostancientofallcrimesandpastimes.Poisonous plants burn his sweetheart’s buttocks, nameless insects sting his; sharp items of the forest floorprickhisknees,insectshers;andallaroundthereabidesasustainedrustle of potential snakes — que dis-je, of semi-extinct dragons! — while the crablike seeds of ferocious flowerscling,inahideousgreencrust,togarteredblacksockandsloppy white sock alike. I am exaggerating a little. One summer noon, just below timberline, where heavenly-hued blossoms that I would fain call larkspur crowded all along a purly mountain brook, we did find,LolitaandI,asecludedromanticspot,ahundredfeetorsoabovethe pass where we had left our car. Theslopeseemeduntrodden.Alastpantingpine Vladimir Nabokov — Lolita 111 was taking a well-earned breather on the rock it had reached. A marmot whistled at us and withdrew. Beneath the lap-robe I had spread for Lo, dry flowerscrepitatedsoftly. Venus came and went. Thejaggedcliffcrowningtheuppertalusanda tangleof shrugs growing below us seemed to offerusprotectionfromsunandmanalike.Alas, I had not reckoned with a faint side trail that curled up in cagey fashion among the shrubs and rocks a few feet from us. It was then that we came close to detection than ever before, and no wonder the experience curbed forever my yearning for rural amours. I remember the operation was over, all over, and she was weeping in my arms; — a salutory storm of sobs after one of the fitsofmoodinessthathadbecomesofrequent with her in the course of that otherwise admirable year! I had just retracted some silly promise she had forced me to make in a moment of blind impatient passion, and thee she was sprawling and sobbing, and pinching my caressing hand, and I was laughing happily, and the atrocious, unbelievable, unbearable, and, I suspect, eternal horror that I know now was still but a dot of blackness in the blue of my bliss; and so we lay, when with one of those jolts that have ended by knocking my poor heart out of its groove, I met the unblinking dark eyes of two strange and beautiful children, faunlet and nymphet, whom their identical flatdarkhairandbloodlesscheeksproclaimed siblings if not twins. Theystoodcrouchingandgapingatus,bothinblueplaysuits, blending with the mountain blossoms. I plucked at the lap-robe for desperate concealment — and within the same instant, something that looked like a polka-dotted pushball among the undergrowth a few paces away, went into a turning motion which was transformed into the gradually rising figureofastoutladywitharaven-black bob, who automatically added a wild lily to her bouquet, while staring over her shoulder at us from behind her lovely carved bluestone children. Now that I have an altogether differentmessonmyconscience,IknowthatIama courageous man, but in those days I was not aware of it, and I remember being surprised by my own coolness. With the quiet murmured order one gives a sweat-stained distracted cringing trained animal even in the worst of plights (what mad hope or hate makes the young beast’s flankspulsate,whatblackstarspiercetheheartofthetamer!),I made Lo get up, and we decorously walked, and then indecorously scuttled down to the car. Behind it a nifty station wagon was parked, and a handsome Assyrian with a little blue-black beard, un monsieur très bien, in silk shirt and magenta slacks, presumably the corpulent botanist’s husband, was gravely taking the picture of a signboard giving the altitude of the pass. It was well over ?0,000 feet and I was quite out of breath; and with a scrunch and a skid we drove off,Lostillstrugglingwithherclothesandswearing at me in language that I never dreamed little girls could know, let alone use. Therewereotherunpleasantincidents.Therewasthemovietheatreonce,forexample. Lo at the time still had for the cinema a veritable passion (it was to decline into tepid condescension during her second high school year). We took in, voluptuously and indiscriminately, oh, I don’t know, one hundred and fiftyortwohundredprogramsduring that one year, and during some of the denser periods of movie-going we saw 112 Lolita — Vladimir Nabokov many of the newsreels up to half-a-dozen times since the same weekly one went with differentmainpicturesandpursuedusfromtowntotown.Herfavoritekindswere,inthis order: musicals, underworlders, westerners. In the first,realsingersanddancershad unreal stage careers in an essentially grief-proof sphere of existence wherefrom death and truth were banned, and where, at the end, white-haired, dewy-eyed, technically deathless, the initially reluctant father of a show-crazy girl always finishedbyapplauding her apotheosis on fabulous Broadway. Theunderworldwasaworldapart:there, heroic newspapermen were tortured, telephone bills ran to billions, and, in a robust atmosphere of incompetent marksmanship, villains were chased through sewers and store-houses by pathologically fearless cops (I was to give them less exercise). Finally there was the mahogany landscape, the florid-faced,blue-eyedroughriders,the prim pretty schoolteacher arriving in Roaring Gulch, the rearing horse, the spectacular stampede, the pistol thrust through the shivered windowpane, the stupendous fistfight,thecrashingmountainofdustyold-fashionedfurniture,thetableusedasa weapon, the timely somersault, the pinned hand still groping for the dropped bowie knife, the grunt, the sweet crash of fistagainstchin,thekickinthebelly,theflyingtackle; and immediately after a plethora of pain that would have hospitalized a Hercules (I should know by now), nothing to show but the rather becoming bruise on the bronzed cheek of the warmed-up hero embracing his gorgeous frontier bride. I remember one matinee in a small airless theatre crammed with children and reeking with the hot breath of popcorn. Themoonwasyellowabovetheneckerchiefedcrooner, and his fingerwasonhisstrumstring,andhisfootwasonapinelog,andI had innocently encircled Lo’s shoulder and approached my jawbone to her temple, when two harpies behind us started muttering the queerest things — I do not know if I understood aright, but what I thought I did, made me withdraw my gentle hand, and of course the rest of the show was fog to me. Another jolt I remember is connected with a little burg we were traversing at night, during our return journey. Some twenty miles earlier I had happened to tell her that the day school she would attend at Beardsley was a rather high-class, non-coeducational one, with no modern nonsense, whereupon Lo treated me to one of those furious harangues of hers where entreaty and insult, self-assertion and double talk, vicious vulgarity and childish despair, were interwoven in an exasperating semblance of logic which prompted a semblance of explanation from me. Enmeshed in her wild words (swell chance… I’d be a sap if I took your opinion seriously… Stinker… You can’t boss me… I despise you… and so forth), I drove through the slumbering town at a fifty-mile-per-hourpaceincontinuanceofmysmoothhighwayswoosh,andatwosome of patrolmen put their spotlight on the car, and told me to pull over. I shushed Lo who was automatically raving on. Themenpeeredatherandmewithmalevolentcuriosity. Suddenly all dimples, she beamed sweetly at them, as she never did at my orchideous masculinity; for, in a sense, my Lo was even more scared of the law than I — and when the kind officerspardonedusandservilelywecrawledon,hereyelidsclosed and flutteredasshemimickedlimpprostration. Vladimir Nabokov — Lolita 113 At this point I have a curious confession to make. You will laugh — but really and truly I somehow never managed to findoutquiteexactlywhatthelegalsituationwas. I do not know it yet. Oh, I have learned a few odds and ends. Alabama prohibits a guardian from changing the ward’s residence without an order of the court; Minnesota, to whom I take offmyhat,providesthatwhenarelativeassumespermanentcare and custody of any child under fourteen, the authority of a court does not come into play. Query: is the stepfather of a gaspingly adorable pubescent pet, a stepfather of only one month’s standing, a neurotic widower of mature years and small but independent means, with the parapets of Europe, a divorce and a few madhouses behind him, is he to be considered a relative, and thus a natural guardian? And if not, must I, and could I reasonably dare notify some Welfare Board and fileapetition(howdoyou fileapetition?),andhaveacourt’sagentinvestigatemeek,fishymeanddangerousDolores Haze? Themanybooksonmarriage,rape,adoptionandsoon,thatIguiltilyconsulted at the public libraries of big and small towns, told me nothing beyond darkly insinuating that the state is the super-guardian of minor children. Pilvin and Zapel, if I remember their names right, in an impressive volume on the legal side of marriage, completely ignored stepfathers with motherless girls on their hands and knees. My best friend, a social service monograph(Chicago, ?936), which was dug out for me at great pains form a dusty storage recess by an innocent old spinster, said “Thereis no principle that every minor must have a guardian; the court is passive and enters the fray only when the child’s situation becomes conspicuously perilous.” A guardian, I concluded, was appointed only when he expressed his solemn and formal desire; but months might elapse before he was given notice to appear at a hearing and grow his pair of gray wings, and in the meantime the fair demon child was legally left to her own devices which, after all, was the case of Dolores Haze. Thencamethehearing.A few questions from the bench, a few reassuring answers from the attorney, a smile, a nod, a light drizzle outside, and the appointment was made. And still I dared not. Keep away, be a mouse, curl up in your hole. Courts became extravagantly active only when there was some monetary question involved: two greedy guardians, a robbed orphan, a third, still greedier, party. But here all was in perfect order, and inventory had been made, and her mother’s small property was waiting untouched for Dolores Haze to grow up. Thebestpolicyseemedtobetorefrainfromanyapplication.Orwould some busybody, some Humane Society, butt in if I kept too quiet? Friend Farlow, who was a lawyer of sorts and ought to have been able to give me some solid advice, was too much occupied with Jean’s cancer to do anything more than what he had promised — namely, to look after Charlotte’s meager estate while I recovered very gradually from the shock of her death. I had conditioned him into believing Dolores was my natural child, and so could not expect him to bother his head about the situation. I am, as the reader must have gathered by now, a poor businessman; but neither ignorance nor indolence should have prevented me from seeking professional advice elsewhere. What stopped me was the awful feeling that if I meddled with fate in any way and tried to rationalize her fantastic gift, that gift would be snatched away 114 Lolita — Vladimir Nabokov like that palace on the mountain top in the Oriental tale which vanished whenever a prospective owner asked its custodian how come a strip of sunset sky was clearly visible from afar between black rock and foundation. I decided that at Beardsley (the site of Bearsley College for Women) I would have access to works of reference that I had not yet been able to study, such as Woerner’s Treatise “On the American Law of Guardianship” and certain United States Children’s Bureau Publications. I also decided that anything was better for Lo than the demoralizing idleness in which she lived. I could persuade her to do so many things — their list might stupefy a professional educator; but no matter how I pleaded or stormed, I could never make her read any other book than the so-called comic books or stories in magazines for American females. Any literature a peg higher smacked to her of school, and though theoretically willing to enjoy A Girl of the Limberlost or the Arabian Nights, or Little Women, she was quite sure she would not fritter away her “vacation” on such highbrow reading matter. I now think it was a great mistake to move east again and have her go to that private school in Beardsley, instead of somehow scrambling across the Mexican border while the scrambling was good so as to lie low for a couple of years in subtropical bliss until I could safely marry my little Creole; for I must confess that depending on the condition of my glands and ganglia, I could switch in the course of the same day from one pole of insanity to the other — from the thought that around ?950 I would have to get rid somehow of a difficultadolescentwhosemagicnymphagehad evaporated — to the thought that with patience and luck I might have her produce eventually a nymphet with my blood in her exquisite veins, a Lolita the Second, who would be eight or nine around ?960, when I would still be dans la force de l’âge; indeed, the telescopy of my mind, or un-mind, was strong enough to distinguish in the remoteness of time a vieillard encore vert — or was it green rot? — bizarre, tender, salivating Dr. Humbert, practicing on supremely lovely Lolita the Thirdtheartofbeing a granddad. In the days of that wild journey of ours, I doubted not that as father to Lolita the First I was a ridiculous failure. I did my best; I read and reread a book with the unintentionally biblical title Know Your Own Daughter, which I got at the same store where I bought Lo, for her thirteenth birthday, a de luxe volume with commercially “beautiful” illustrations, of Andersen’s TheLittleMermaid. But even at our very best moments, when we sat reading on a rainy day (Lo’s glance skipping from the window to her wrist watch and back again), or had a quiet hearty meal in a crowded diner, or played a childish game of cards, or went shopping, or silently stared, with other motorists and their children, at some smashed, blood-bespattered car with a young woman’s shoe in the ditch (Lo, as we drove on: “that was the exact type of moccasin I was trying to describe to that jerk in the store”); on all those random occasions, I seemed to myself as implausible a father as she seemed to be a daughter. Was, perhaps, guilty locomotion instrumental in vitiating our powers of impersonation? Would improvement be forthcoming with a fixeddomicileandaroutineschoolgirl’sday? Vladimir Nabokov — Lolita 115 In my choice of Beardsley I was guided not only by the fact of there being a comparatively sedate school for girls located there, but also by the presence of the women’s college. In my desire to get myself casé, to attach myself somehow to some patterned surface which my stripes would blend with, I thought of a man I knew in the department of French at Beardsley College; he was good enough to use my textbook in his classes and had attempted to get me over once to deliver a lecture. I had no intention of doing so, since, as I have once remarked in the course of these confessions, there are few physiques I loathe more than the heavy low-slung pelvis, thick calves and deplorable complexion of the average coed (in whom I see, maybe, the coffinofcoarse female fleshwithinwhichmynymphetsareburiedalive);butIdidcravefora label, a background, and a simulacrum, and, as presently will become clear, there was a reason, a rather zany reason, why old Gaston Godin’s company would be particularly safe. Finally, there was the money question. My income was cracking under the strain of our joy-ride. True, I clung to the cheaper motor courts; but every now and then, there would be a loud hotel de luxe, or a pretentious dude ranch, to mutilate our budget; staggering sums, moreover, were expended on sightseeing and Lo’s clothes, and the old Haze bus, although a still vigorous and very devoted machine, necessitated numerous minor and major repairs. In one of our strip maps that has happened to survive among the papers which the authorities have so kindly allowed me to use for the purpose of writing my statement, I findsomejottingsthathelpmecomputethe following. During that extravagant year ?947-?948, August to August, lodgings and food cost us around 5,500 dollars; gas, oil and repairs, ?,234, and various extras almost as much; so that during about ?50 days of actual motion (we covered about 27,000 miles!) plus some 200 days of interpolated standstills, this modest rentier spent around 8,000 dollars, or better say ?0,000 because, unpractical as I am, I have surely forgotten a number of items. And so we rolled East, I more devastated than braced with the satisfaction of my passion, and she glowing with health, her bi-iliac garland still as brief as a lad’s, although she had added two inches to her stature and eight pounds to her weight. We had been everywhere. We had really seen nothing. And I catch myself thinking that our long journey had only defiledwithasinuoustrailofslimethelovely,trustful,dreamy, enormous country that by then, in retrospect, was no more to us than a collection of dog-eared maps, ruined tour books, old tires, and her sobs in the night — every night, every night — the moment I feigned sleep. 4 When, through decorations of light and shade, we drove to ?4 ThayerStreet,agravelittle lad met us with the keys and a note from Gaston who had rented the house for us. My Lo, without granting her new surroundings one glance, unseeingly turned on 116 Lolita — Vladimir Nabokov the radio to which instinct led her and lay down on the living room sofa with a batch of old magazines which in the same precise and blind manner she landed by dipping her hand into the nether anatomy of a lamp table. I really did not mind where to dwell provided I could lock my Lolita up somewhere; but I had, I suppose, in the course of my correspondence with vague Gaston, vaguely visualized a house of ivied brick. Actually the place bore a dejected resemblance to the Haze home (a mere 400 distant): it was the same sort of dull gray frame affairwithashingledroofanddullgreendrillawnings;andtherooms,thoughsmallerand furnished in a more consistent plush-and-plate style, were arranged in much the same order. My study turned out to be, however, a much larger room, lined from floortoceilingwithsometwothousandbooksonchemistrywhichmylandlord(onsabbatical leave for the time being) taught at Beardsley College. I had hoped Beardsley School for girls, an expensive day school, with lunch thrown in and a glamorous gymnasium, would, while cultivating all those young bodies, provide some formal education for their minds as well. Gaston Godin, who was seldom right in his judgment of American habitus, had warned me that the institution might turn out to be one of those where girls are taught, as he put it with a foreigner’s love for such things: “not to spell very well, but to smell very well.” I don’t think they achieved even that. At my firstinterviewwithheadmistressPratt,sheapprovedofmychild’s“niceblueeyes” (blue! Lolita!) and of my own friendship with that “French genius” (a genius! Gaston!) — and then, having turned Dolly over to a Miss Cormorant, she wrinkled her brow in a kind of recueillement and said: “We are not so much concerned, Mr. Humbird, with having our students become bookworms or be able to reel offallthecapitalsofEuropewhichnobodyknowsanyway, or learn by heart the dates of forgotten battles. What we are concerned with is the adjustment of the child to group life. ThisiswhywestressthefourD’s:Dramatics, Dance, Debating and Dating. We are confronted by certain facts. Your delightful Dolly will presently enter an age group where dates, dating, date dress, date book, date etiquette, mean as much to her as, say, business, business connections, business success, mean to you, or as much as [smiling] the happiness of my girls means to me. Dorothy Humbird is already involved in a whole system of social life which consists, whether we like it or not, of hot-dog stands, corner drugstores, malts and cokes, movies, square-dancing, blanket parties on beaches, and even hair-fixingparties!Naturally at Beardsley School we disapprove of some of these activities; and we rechannel others into more constructive directions. But we do try to turn our backs on the fog and squarely face the sunshine. To put it briefly,whileadoptingcertainteachingtechniques, we are more interested in communication than in composition. Thatis,withdue respect to Shakespeare and others, we want our girls to communicate freely with the live world around them rather than plunge into musty old books. We are still groping perhaps, but we grope intelligently, like a gynecologist feeling a tumor. We thing, Dr. Humburg, in organismal and organizational terms. We have done away Vladimir Nabokov — Lolita 117 with the mass or irrelevant topics that have traditionally been presented to young girls, leaving no place, in former days, for the knowledges and the skills, and the attitudes they will need in managing their lives and — as the cynic might add — the lives of their husbands. Mr. Humberson, let us put it this way: the position of a star is important, but the most practical spot for an icebox in the kitchen may be even more important to the budding housewife. You say that all you expect a child to obtain from school is a sound education. But what do we mean by education? In the old days it was in the main a verbal phenomenon; I mean, you could have a child learn by heart a good encyclopedia and he or she would know as much as or more than a school could offer.Dr. Hummer, do you realize that for the modern pre-adolescent child, medieval dates are of less vital value than weekend ones [twinkle]? — to repeat a pun that I heard the Beardsley college psychoanalyst permit herself the other day. We live not only in a world of thoughts, but also in a world of things. Words without experience are meaningless. What on earth can Dorothy Hummerson care for Greece and the Orient with their harems and slaves?” Thisprogramratherappalledme,butIspoketotwointelligentladieswhohadbeen connected with the school, and they affirmedthatthegirlsdidquitea bitofsound reading and that the “communication” line was more or less ballyhoo aimed at giving old-fashioned Beardsley School a financiallyremunerativemoderntouch,though actually it remained as prim as a prawn. Another reason attracting me to that particular school may seem funny to some readers, but it was very important to me, for that is the way I am made. Across our street, exactly in front of our house, there was, I noticed, a gap of weedy wasteland, with some colorful bushes and a pile of bricks and a few scattered planks, and the foam of shabby mauve and chrome autumn roadside flowers;andthroughthatgapyoucould see a shimmery section of School Rd., running parallel to our ThayerSt.,andimmediately beyond that, the playground of the school Apart from the psychological comfort this general arrangement should affordmebykeepingDolly’sdayadjacentto mine, I immediately foresaw the pleasure I would have in distinguishing from my study-bedroom, by means of powerful binoculars, the statistically inevitable percentage of nymphets among the other girl children playing around Dolly during recess; unfortunately, on the very firstdayofschool,workmenarrivedandputupafencesomeway down the gap, and in no time a construction of tawny wood maliciously arose beyond that fence utterly blocking my magic vista; and as soon as they had erected a sufficientamountofmaterialtospoileverything,thoseabsurdbuilderssuspendedtheir work and never appeared again. 5 In a street called ThayerStreet,intheresidentialgreen,fawn,andgoldenofamellow academic townlet, one was bound to have a few amiable fine-dayersyelpingat 118 Lolita — Vladimir Nabokov you. I prided myself on the exact temperature of my relations with them: never rude, always aloof. My west-door neighbor, who might have been a businessman or a college teacher, or both, would speak to me once in a while as he barbered some late garden blooms or watered his car, or, at a later date, defrosted his driveway (I don’t mind if these verbs are all wrong), but my brief grunts, just sufficientlyarticulatetosound like conventional assents or interrogative pause-fillers,precludedanyevolution toward chumminess. Of the two houses flankingthebitofscrubbywasteopposite, one was closed, and the other contained two professors of English, tweedy and short-haired Miss Lester and fadedly feminine Miss Fabian, whose only subject of brief sidewalk conversation with me was (God bless their tact!) the young loveliness of my daughter and the naïve charm of Gaston Godin. My east-door neighbor was by far the most dangerous one, a sharp-nosed stock character whose late brother had been attached to the College as Superintendent of Buildings and Grounds. I remember her waylaying Dolly, while I stood at the living room window, feverishly awaiting my darling’s return from school. Theodiousspinster,tryingtoconcealher morbid inquisitiveness under a mask of dulcet goodwill, stood leaning on her slim umbrella (the sleet had just stopped, a cold wet sun had sidled out), and Dolly, her brown coat open despite the raw weather, her structural heap of books pressed against her stomach, her knees showing pink above her clumsy wellingtons, a sheepish frightened little smile flittingoverandoffhersnub-nosedface,which— owingperhaps to the pale wintry light — looked almost plain, in a rustic, German, Mägdlein-like way, as she stood there and dealt with Miss East’s questions “And where is your mother, my dear? And what is your poor father’s occupation? And where did you love before?” Another time the loathsome creature accosted me with a welcoming whine — but I evaded her; and a few days later there came from her a note in a blue-margined envelope, a nice mixture of poison and treacle, suggesting Dolly come over on a Sunday and curl up in a chair to look through the “loads of beautiful books my dear mother gave me when I was a child, instead of having the radio on at full blast till all hours of the night.” I had also to be careful in regard to a Mrs. Holigan, a charwoman and cook of sorts whom I had inherited with the vacuum cleaner from the previous tenants. Dolly got lunch at school, so that this was no trouble, and I had become adept at providing her with a big breakfast and warming up the dinner that Mrs. Holigan prepared before leaving. Thatkindlyandharmlesswomanhad,thankGod,aratherblearyeyethat missed details, and I had become a great expert in bedmaking; but still I was continuously obsessed by the feeling that some fatal stain had been left somewhere, or that, on the rare occasions where Holigan’s presence happened to coincide with Lo’s, simple Lo might succumb to buxom sympathy in the course of a cozy kitchen chat. I often felt we lived in a lighted house of glass, and any moment some thin-lipped parchment face would peer through a carelessly unshaded window to obtain a free glimpse of things that the most jaded voyeur would have paid a small fortune to watch. Vladimir Nabokov — Lolita 119 6 A word about Gaston Godin. ThemainreasonwhyIenjoyed—oratleasttoleratedwith relief — his company was the spell of absolute security that his ample person cast on my secret. Not that he knew it; I had no special reason to confideinhim,and he was much too self-centered and abstract to notice or suspect anything that might lead to a frank question on his part and a frank answer on mine. He spoke well of me to Beardsleyans, he was my good herald. Had he discovered mes goûts and Lolita’s status, it would have interested him only insofar as throwing some light on the simplicity of my attitude toward him, which attitude was as free of polite strain as it was of ribald allusions; for despite his colorless mind and dim memory, he was perhaps aware that I knew more about him than the burghers of Beardsley did. He was a flabby,dough-faced,melancholybachelortaperingupwardtoapairofnarrow, not quite level shoulders and a conical pear-head which had sleek black hair on one side and only a few plastered wisps on the other. But the lower part of his body was enormous, and he ambulated with a curious elephantine stealth by means of phenomenally stout legs. He always wore black, even his tie was black; he seldom bathed; his English was a burlesque. And, nonetheless, everybody considered him to be a supremely lovable, lovably freakish fellow! Neighbors pampered him; he knew by name all the small boys in our vicinity (he lived a few blocks away from me)and had some of them clean his sidewalk and burn leaves in his back yard, and bring wood from his shed, and even perform simple chores about the house, and he would feed them fancy chocolates, with real liqueurs inside — in the privacy of an orientally furnished den in his basement, with amusing daggers and pistols arrayed on the moldy, rug-adorned walls among the camouflagedhot-waterpipes.Upstairshehad a studio — he painted a little, the old fraud. He had decorated its sloping wall (it was really not more than a garret) with large photographs of pensive André Gide, Tchaïkovsky, Norman Douglas, two other well-known English writers, Nijinsky (all thighs and figleaves),HaroldD.Doublename(amisty-eyedleft-wingprofessorata Midwestern university) and Marcel Proust. All these poor people seemed about to fall on you from their inclined plane. He had also an album with snapshots of all the Jackies and Dickies of the neighborhood, and when I happened to thumb through it and make some casual remark, Gaston would purse his fat lips and murmur with a wistful pout “Oui, ils sont gentils.” His brown eyes would roam around the various sentimental and artistic bric-a-brac present, and his own banal toiles (the conventionally primitive eyes, sliced guitars, blue nipples and geometrical designs of the day), and with a vague gesture toward a painted wooden bowl or veined vase, he would say “Prenez donc une de ces poires. La bonne dame d’en face m’en offreplusquejen’en peux savourer.” Or: “Mississe Taille Lore vient de me donner ces dahlias, belles fleursque j’exècre.” (Somber, sad, full of world-weariness.) For obvious reasons, I preferred my house to his for the games of chess we had two or three times weekly. He looked like some old battered idol as he sat with his 120 Lolita — Vladimir Nabokov pudgy hands in his lap and stared at the board as if it were a corpse. Wheezing he would mediate for ten minutes — then make a losing move. Or the good man, after even more thought, might utter: Au roi! with a slow old-dog woof that had a gargling sound at the back of it which made his jowls wabble; and then he would lift his circumflexeyebrowswithadeepsighasIpointedouttohimthathewasincheck himself. Sometimes, from where we sat in my cold study I could hear Lo’s bare feet practicing dance techniques in the living room downstairs; but Gaston’s outgoing senses were comfortably dulled, and he remained unaware of those naked rhythms — and-one, and-two, and-one, and-two, weight transferred on a straight right leg, leg up and out to the side, and-one, and-two, and only when she started jumping, opening her legs at the height of the jump, and flexingoneleg,andextendingtheother,andflying,andlandingonhertoes—onlythendidmypale,pompous,moroseopponentrub his head or cheek a if confusing those distant thuds with the awful stabs of my formidable Queen. Sometimes Lola would slouch in while we pondered the board — and it was every time a treat to see Gaston, his elephant eye still fixedonhispieces,ceremoniouslyriseto shake hands with her, and forthwith release her limp fingers,andwithoutlookingonce at her, descend again into his chair to topple into the trap I had laid for him. One day around Christmas, after I had not seen him for a fortnight or so, he asked me “Et toutes vos fillettes,ellesvontbien?” from which it became evident to me that he had multiplied my unique Lolita by the number of sartorial categories his downcast moody eye had glimpsed during a whole series of her appearances: blue jeans, a skirt, shorts, a quilted robe. I am loath to dwell so long on the poor fellow (sadly enough, a year later, during a voyage to Europe, from which he did not return, he got involved in a sale histoire, in Naples of all places!). I would have hardly alluded to him at all had not his Beardsley existence had such a queer bearing on my case. I need him for my defense. Therehewas devoid of any talent whatsoever, a mediocre teacher, a worthless scholar, a glum repulsive fat old invert, highly contemptuous of the American way of life, triumphantly ignorant of the English language — there he was in priggish New England, crooned over by the old and caressed by the young — oh, having a grand time and fooling everybody; and here was I. 7 I am now faced with the distasteful task of recording a definitedropinLolita’smorals.If her share in the ardors she kindled had never amounted to much, neither had pure lucre ever come to the fore. But I was weak, I was not wise, my school-girl nymphet had me in thrall. With the human element dwindling, the passion, the tenderness, and the torture only increased; and of this she took advantage. Vladimir Nabokov — Lolita 121 Her weekly allowance, paid to her under condition she fulfillherbasicobligations, was twenty-one cents at the start of the Beardsley era — and went up to one dollar fivebeforeitsend.Thiswasa morethangenerousarrangementseeingsheconstantly received from me all kinds of small presents and had for the asking any sweetmeat or movie under the moon — although, of course, I might fondly demand an additional kiss, or even a whole collection of assorted caresses, when I knew she coveted very badly some item of juvenile amusement. She was, however, not easy to deal with. Only very listlessly did she earn her three pennies — or three nickels — per day; and she proved to be a cruel negotiator whenever it was in her power to deny me certain life-wrecking, strange, slow paradisal philters without which I could not live more than a few days in a row, and which, because of the very nature of love’s languor, I could not obtain by force. Knowing the magic and might of her own soft mouth, she managed — during one schoolyear! — to raise the bonus price of a fancy embrace to three, and even four bucks! O Reader! Laugh not, as you imagine me, on the very rack of joy noisily emitting dimes and quarters, and great big silver dollars like some sonorous, jingly and wholly demented machine vomiting riches; and in the margin of that leaping epilepsy she would firmlyclutchahandfulofcoinsinherlittlefist,which, anyway, I used to pry open afterwards unless she gave me the slip, scrambling away to hide her loot. And just as every other day I would cruise all around the school area and on comatose feet visit drugstores, and peer into foggy lanes, and listen to receding girl laughter in between my heart throbs and the falling leaves, so every now and then I would burgle her room and scrutinize torn papers in the wastebasket with the painted roses, and look under the pillow of the virginal bed I had just made myself. Once I found eight one-dollar notes in one of her books (fittingly—Treasure Island), and once a hole in the wall behind Whistler’s Mother yielded as much as twenty-four dollars and some change — say twenty-four sixty — which I quietly removed, upon which, next day, she accused, to my face, honest Mrs. Holigan of being a filthythief.Eventually, she lived up to her I.Q. by findingasaferhoardingplacewhichIneverdiscovered; but by that time I had brought prices down drastically by having her earn the hard and nauseous way permission to participate in the school’s theatrical program; because what I feared most was not that she might ruin me, but that she might accumulate sufficientcashtorunaway.I believethepoorfierce-eyedchildhadfiguredout that with a mere fiftydollarsinherpurseshemightsomehowreachBroadwayor Hollywood — or the foul kitchen of a diner (Help Wanted) in a dismal ex-prairie state, with the wind blowing, and the stars blinking, and the cars, and the bars, and the barmen, and everything soiled, torn, dead. 8 I did my best, your Honor, to tackle the problem of boys. Oh, I used even to read in the Beardsley Star a so-called Column for Teens, to findouthowtobehave! 122 Lolita — Vladimir Nabokov A word to fathers. Don’t frighten away daughter’s friend. Maybe it is a bit hard for you to realize that now the boys are findingherattractive.Toyousheisstillalittlegirl.Tothe boys she’s charming and fun, lovely and gay. Theylikeher.Todayyouclinchbigdeals in an executive’s office,butyesterdayyouwerejusthighschoolJimcarryingJane’sschool books. Remember? Don’t you want your daughter, now that her turn has come, to be happy in the admiration and company of boys she likes? Don’t you want your daughter, now that her turn has come, to be happy in the admiration and company of boys she likes? Don’t you want them to have wholesome fun together? Wholesome fun? Good Lord! Why not treat the young fellows as guests in your house? Why not make conversation with them? Draw them out, make them laugh and feel at ease? Welcome, fellow, to this bordello. If she breaks the rules don’t explode out loud in front of her partner in crime. Let her take the brunt of your displeasure in private. And stop making the boys feel she’s the daughter of an old ogre. First of all the old ogre drew up a list under “absolutely forbidden” and another under “reluctantly allowed.” Absolutely forbidden were dates, single or double or triple — the next step being of course mass orgy. She might visit a candy bar with her girl friends, and there giggle-chat with occasional young males, while I waited in the car at a discreet distance; and I promised her that if her group were invited by a socially acceptable group in Butler’s Academy for Boys for their annual ball (heavily chaperoned, of course), I might consider the question whether a girl of fourteen can don her first“formal”(akindofgownthatmakesthin-armedteen-agerslooklikeflamingoes). Moreover, I promised her to throw a party at our house to which she would be allowed to invite her prettier girl friends and the nicer boys she would have met by that time at the Butler dance. But I was quite positive that as long as my regime lasted she would never, never be permitted to go with a youngster in rut to a movie, or neck in a car, or go to boy-girl parties at the houses of schoolmates, or indulge out of my earshot in boy-girl telephone conversations, even if “only discussing his relations with a friend of mine.” Lo was enraged by all this — called me a lousy crook and worse — and I would probably have lost my temper had I not soon discovered, to my sweetest relief, that what really angered her was my depriving her not of a specificsatisfactionbutofageneral right. I was impinging, you see, on the conventional program, the stock pastimes, the “things that are done,” the routine of youth; for there is nothing more conservative than a child, especially a girl-child, be she the most auburn and russet, the most mythopoeic nymphet in October’s orchard-haze. Vladimir Nabokov — Lolita 123 Do not misunderstand me. I cannot be absolutely certain that in the course of the winter she did not manage to have, in a casual way, improper contacts with unknown young fellows; of course, no matter how closely I controlled her leisure, there would constantly occur unaccounted-for time leaks with over-elaborate explanations to stop them up in retrospect; of course, my jealousy would constantly catch its jagged claw in the finefabricsofnymphetfalsity;butIdiddefinitelyfeel— andcannowvouchsafe for the accuracy of my feeling — that there was no reason for serious alarm. I felt that way not because I never once discovered any palpable hard young throat to crush among the masculine mutes that flickeredsomewhereinthebackground;butbecause it was to me “overwhelmingly obvious” (a favorite expression with my aunt Sybil) that all varieties of high school boys — from the perspiring nincompoop whom “holding hands” thrills, to the self-sufficientrapistwithpustulesanda souped-upcar— equallybored my sophisticated young mistress. “All this noise about boys gags me,” she had scrawled on the inside of a schoolbook, and underneath, in Mona’s hand (Mona is due any minute now), there was the sly quip: “What about Rigger?” (due too). Faceless, then, are the chappies I happened to see in her company. Therewasforinstance Red Sweater who one day, the day we had the firstsnow—sawherhome;fromthe parlor window I observed them talking near our porch. She wore her firstclothcoat with a fur collar; there was a small brown cap on my favorite hairdo — the fringe in front and the swirl at the sides and the natural curls at the back — and her damp-dark moccasins and white socks were more sloppy than ever. She pressed as usual her books to her chest while speaking or listening, and her feet gestured all the time: she would stand on her left instep with her right toe, remove it backward, cross her feet, rock slightly, sketch a few steps, and then start the series all over again. TherewasWindbreaker who talked to her in front of a restaurant one Sunday afternoon while his mother and sister attempted to walk me away for a chat; I dragged along and looked back at my only love. She had developed more than one conventional mannerism, such as the polite adolescent way of showing one is literally “doubled up” with laughter by inclining one’s head, and so (as she sensed my call), still feigning helpless merriment, she walked backward a couple of steps, and then faced about, and walked toward me with a fading smile. On the other hand, I greatly liked — perhaps because it reminded me of her firstunforgettableconfession—hertrickofsighing“ohdear!”in humorous wistful submission to fate, or emitting a long “no-o” in a deep almost growling undertone when the blow of fate had actually fallen. Above all — since we are speaking of movement and youth — I liked to see her spinning up and down ThayerStreet on her beautiful young bicycle: rising on the pedals to work on them lustily, then sinking back in a languid posture while the speed wore itself off;andthenshewould stop at our mailbox and, still astride, would flipthroughamagazineshefoundthere, and put it back, and press her tongue to one side of her upper lip and push offwith her foot, and again sprint through pale shade and sun. On the whole she seemed to me better adapted to her surroundings than I had hoped she would be when considering my spoiled slave-child and the bangles of de124 Lolita — Vladimir Nabokov meanor she naïvely affectedthewinterbeforeinCalifornia.AlthoughIcouldneverget used to the constant state of anxiety in which the guilty, the great, the tenderhearted live, I felt I was doing my best in the way of mimicry. As I lay on my narrow studio bed after a session of adoration and despair in Lolita’s cold bedroom, I used to review the concluded day by checking my own image as it prowled rather than passed before the mind’s red eye. I watched dark-and-handsome, not un-Celtic, probably high-church, possibly very high-church, Dr. Humbert see his daughter offtoschoolIwatchedhimgreetwithhisslowsmileandpleasantlyarchedthickblack ad-eyebrows good Mrs. Holigan, who smelled of the plague (and would head, I knew, for master’s gin at the firstopportunity).WithMr.West,retiredexecutioneror writer of religious tracts — who cared? — I saw neighbor what’s his name, I think they are French or Swiss, meditate in his frank-windowed study over a typewriter, rather gaunt-profiled,analmostHitleriancowlickonhispalebrow.Weekends,wearing a well-tailored overcoat and brown gloves, Professor H. might be seen with his daughter strolling to Walton Inn (famous for its violet-ribboned china bunnies and chocolate boxes among which you sit and wait for a “table for two” still filthywith your predecessor’s crumbs). Seen on weekdays, around one p.m. , saluting with dignity Argus-eyed East while maneuvering the car out of the garage and around the damned evergreens, and down onto the slippery road. Raising a cold eye from book to clock in the positively sultry Beardsley College library, among bulky young women caught and petrifiedintheoverflowofhumanknowledge.Walkingacrossthe campus with the college clergyman, the Rev. Rigger (who also taught Bible in Beardsley School). “Somebody told me her mother was a celebrated actress killed in an airplane accident. Oh? My mistake, I presume. Is that so? I see. How sad.” (Sublimating her mother, eh?) Slowly pushing my little pram through the labyrinth of the supermarket, in the wake of Professor W., also a slow-moving and gentle widower with the eyes of a goat. Shoveling the snow in my shirt-sleeves, a voluminous black and white muffleraroundmyneck.Followingwithnoshowofrapacioushaste (even taking time to wipe my feet on the mat) my school-girl daughter into the house. Taking Dolly to the dentist — pretty nurse beaming at her — old magazines — ne montrez pas vos zhambes. At dinner with Dolly in town, Mr. Edgar H. Humbert was seen eating his steak in the continental knife-and-fork manner. Enjoying, in duplicate, a concert: two marble-faced, becalmed Frenchmen sitting side by side, with Monsieur H.H.’s musical little girl on her father’s right, and the musical little boy of Professor W. (father spending a hygienic evening in Providence) on Monsieur G.G.’s left. Opening the garage, a square of light that engulfs the car and is extinguished. Brightly pajamaed, jerking down the window shade in Dolly’s bedroom. Saturday morning, unseen, solemnly weighing the winter-bleached lassie in the bathroom. Seen and heard Sunday morning, no churchgoer after all, saying don’t be too late, to Dolly who is bound for the covered court. Letting in a queerly observant schoolmate of Dolly’s: “First time I’ve seen a man wearing a smoking jacket, sir — except in movies, of course.” Vladimir Nabokov — Lolita 125 9 Her girlfriends, whom I looked forward to meet, proved on the whole disappointing. TherewasOpalSomething,andLindaHall,andAvisChapman,andEvaRosen,and Mona Dahl (save one, all these names are approximations, of course). Opal was a bashful, formless, bespectacled, bepimpled creature who doted on Dolly who bullied her. With Linda Hall the school tennis champion, Dolly played singles at least twice a week: I suspect Linda was a true nymphet, but for some unknown reason she did not come — was perhaps not allowed to come — to our house; so I recall her only as a flashofnaturalsunshineonanindoorcourt.Oftherest,nonehadanyclaims to nymphetry except Eva Rosen. Avis was a plump lateral child with hairy legs, while Mona, though handsome in a coarse sensual way and only a year older than my aging mistress, had obviously long ceased to be a nymphet, if she ever had been one. Eva Rosen, a displaced little person from France, was on the other hand a good example of a not strikingly beautiful child revealing to the perspicacious amateur some of the basic elements of nymphet charm, such as a perfect pubescent figureandlingeringeyesandhighcheekbones.HerglossycopperhairhadLolita’ssilkiness, and the features of her delicate milky-white face with pink lips and silverfisheyelasheswerelessfoxythanthoseofherlikes—thegreatclanofintra-racialredheads; nor did she sport their green uniform but wore, as I remember her, a lot of black or cherry dark — a very smart black pullover, for instance, and high-heeled black shoes, and garnet-red fingernailpolish.IspokeFrenchtoher(muchtoLo’sdisgust).Thechild’stonalitieswerestilladmirablypure,butforschoolwordsandplaywordsshe resorted to current American and then a slight Brooklyn accent would crop up in her speech, which was amusing in a little Parisian who went to a select New England school with phoney British aspirations. Unfortunately, despite “that French kid’s uncle” being “a millionaire,” Lo dropped Eva for some reason before I had had time to enjoy in my modest way her fragrant presence in the Humbert open house. ThereaderknowswhatimportanceIattachedtohavingabevyofpagegirls,consolation prize nymphets, around my Lolita. For a while, I endeavored to interest my senses in Mona Dahl who was a good deal around, especially during the spring term when Lo and she got so enthusiastic about dramatics. I have often wondered what secrets outrageously treacherous Dolores Haze had imparted to Mona while blurting out to me by urgent and well-paid request various really incredible details concerning an affairthatMonahadhadwithamarineattheseaside.Itwascharacteristic of Lo that she chose for her closest chum that elegant, cold, lascivious, experienced young female whom I once heard (misheard, Lo swore) cheerfully say in the hallway to Lo — who had remarked that her (Lo’s) sweater was of virgin wool: “Theonlythingaboutyouthatis,kiddo…”Shehadacuriouslyhuskyvoice,artificially waved dull dark hair, earrings, amber-brown prominent eyes and luscious lips. Lo said teachers had remonstrated with her on her loading herself with so much costume jewelry. Her hands trembled. She was burdened with a ?50 I.Q. And I also 126 Lolita — Vladimir Nabokov knew she had a tremendous chocolate-brown mole on he womanish back which I inspected the night Lo and she had worn low-cut pastel-colored, vaporous dresses for a dance at the Butler Academy. I am anticipating a little, but I cannot help running my memory all over the keyboard of that school year. In the meeting my attempts to findoutwhatkindofboysLo knew, Miss Dahl was elegantly evasive. Lo who had gone to play tennis at Linda’s country club had telephoned she might be a full half hour late, and so, would I entertain Mona who was coming to practice with her a scene from TheTamingoftheShrew. Using all the modulations, all the allure of manner and voice she was capable of and staring at me with perhaps — could I be mistaken? — a faint gleam of crystalline irony, beautiful Mona replied: “Well, sir, the fact is Dolly is not much concerned with mere boys. Fact is, we are rivals. She and I have a crush on the Reverend Rigger.” (Thiswasa joke — I have already mentioned that gloomy giant of a man, with the jaw of a horse: he was to bore me to near murder with his impressions of Switzerland at a tea party for parents that I am unable to place correctly in terms of time.) How had the ball been? Oh, it had been a riot. A what? A panic. Terrific,ina word. Had Lo danced a lot? Oh, not a frightful lot, just as much as she could stand. What did she, languorous Mona, think of Lo? Sir? Did she think Lo was doing well at school? Gosh, she certainly was quite a kid. But her general behavior was —? Oh, she was a swell kid. But still? “Oh, she’s a doll,” concluded Mona, and sighed abruptly, and picked up a book that happened to lie at hand, and with a change of expression, falsely furrowing her brow, inquired: “Do tell me about Ball Zack, sir. Is he really that good?” She moved up so close to my chair that I made out through lotions and creams her uninteresting skin scent. A sudden odd thought stabbed me: was my Lo playing the pimp? If so, she had found the wrong substitute. Avoiding Mona’’ cool gaze, I talked literature for a minute. ThenDollyarrived—andslitherpaleeyesatus.I left the two friends to their own devices. One of the latticed squares in a small cobwebby casement window at the turn of the staircase was glazed with ruby, and that raw wound among the unstained rectangles and its asymmetrical position — a night’s move from the top — always strangely disturbed me. 10 Sometimes… Come on, how often exactly, Bert? Can you recall four, five,moresuchoccasions? Or would no human heart have survived two or three? Sometimes (I have nothing to say in reply to your question), while Lolita would be haphazardly preparing her homework, sucking a pencil, lolling sideways in an easy chair with both legs over its arm, I would shed all my pedagogic restraint, dismiss all our quarrels, forget all my masculine pride — and literally crawl on my knees to your chair, my Lolita! You would give me one look — a gray furry question mark of a look: “Oh no, not again” (incredulity, exasperation); for you never deigned to believe that I could, without any Vladimir Nabokov — Lolita 127 specificdesigns,evercravetoburymyfaceinyourplaidskirt,mydarling!Thefragility of those bare arms of yours — how I longed to enfold them, all your four limpid lovely limbs, a folded colt, and take your head between my unworthy hands, and pull the temple-skin back on both sides, and kiss your chinesed eyes, and — “Pulease, leave me alone, will you,” you would say, “for Christ’s sake leave me alone.” And I would get up from the floorwhileyoulookedon,yourfacedeliberatelytwitchinginimitationof my tic nerveux. But never mind, never mind, I am only a brute, never mind, let us go on with my miserable story. 11 One Monday forenoon, in December I think, Pratt asked me to come over for a talk. Dolly’s last report had been poor, I knew. But instead of contenting myself with some such plausible explanation of this summons, I imagined all sort of horrors, and had to fortify myself with a pint of my “pin” before I could face the interview. Slowly, all Adam’s apple and heart, I went up the steps of the scaffold. A huge women, gray-haired, frowsy, with a broad flatnoseandsmalleyesbehindblack-rimmed glasses — “Sit down,” she said, pointing to an informal and humiliating hassock, while she perched with ponderous spryness on the arm of an oak chair. For a moment or two, she peered at me with smiling curiosity. She had done it at our firstmeeting, I recalled, but I could affordthentoscowlback.Hereyeleftme.Shelapsedinto thought — probably assumed. Making up her mind she rubbed, fold on fold, her dark gray flannelskirtattheknee,dispellingatraceofchalkorsomething.Thenshesaid, still rubbing, not looking up: “Let me ask a blunt question, Mr. Haze. You are an old-fashioned Continental father, aren’t you?” “Why, no,” I said, “conservative, perhaps, but not what you would call old-fashioned.” She sighed, frowned, then clapped her big plump hands together in a let’s-get-down-to-business manner, and again fixedherbeadyeyesuponme. “Dolly Haze,” she said, “is a lovely child, but the onset of sexual maturing seems to give her trouble.” I bowed slightly. What else could I do? “She is still shuttling,” said Miss Pratt, showing how with her liver-spotted hands, “between the anal and genital zones of development. Basically she is a lovely —” “I beg your pardon,” I said, “what zones?” “That’stheold-fashionedEuropeaninyou!”criedPrattdeliveringaslighttaponmy wrist watch and suddenly disclosing her dentures. “All I mean is that biologic drives — do you smoke? — are not fused in Dolly, do not fall so to speak into a — into a rounded pattern.” Her hands held for a moment an invisible melon. 128 Lolita — Vladimir Nabokov “She is attractive, bright though careless” (breathing heavily, without leaving her perch, the woman took time out to look at the lovely child’s report sheet on the desk at her right). “Her marks are getting worse and worse. Now I wonder, Mr. Haze —” Again the false meditation. “Well,” she went on with zest, “as for me, I do smoke, and, as dear Dr. Pierce used to say: I’m not proud of it but I jeest love it.” She lit up and the smoke she exhaled from her nostrils was like a pair of tusks. “Let me give you a few details, it won’t take a moment. Now here let me see [rummaging among her papers]. She is defianttowardMissRedcockandimpossiblyrudetoMiss Cormorant. Now here is one of our special research reports: Enjoys singing with group in class though mind seems to wander. Crosses her knees and wags left leg to rhythm. Type of by-words: a two-hundred-forty-two word area of the commonest pubescent slang fenced in by a number of obviously European polysyllabics. Sighs a good deal in class. Let me see. Yes. Now comes the last week in November. Sighs a good deal in class. Chews gum vehemently. Does not bite her nails though if she did, this would conform better to her general pattern — scientificallyspeaking,ofcourse.Menstruation,according to the subject, well established. Belongs at present to no church organization. By the way, Mr. Haze, her mother was —? Oh, I see. And you are —? Nobody’s business is, I suppose, God’s business. Something else we wanted to know. She was no regular home duties, I understand. Making a princess of your Dolly, Mr. Haze, he? Well, what else have we got here? Handles books gracefully. Voice pleasant. Giggles rather often. A little dreamy. Has private jokes of her own, transposing for instance the firstlettersof some of her teachers names. Hair light and dark brown, lustrous — well [laughing] you are aware of that, I suppose. Nose unobstructed, feet high-arched, eyes — let me see, I had here somewhere a still more recent report. Aha, here we are. Miss Gold says Dolly’s tennis form is excellent to superb, even better than Linda Hall’s, but concentration and point-accumulation are just “poor to fair.” Miss Cormorant cannot decide whether Dolly has exceptional emotional control or none at all. Miss Horn reports she — I mean, Dolly — cannot verbalize her emotions, while according to Miss Cole Dolly’s metabolic efficiencyissuperfine.MissMolarthinksDollyis myopicandshouldsee a good ophthalmologist, but Miss Redcock insists that the girl simulates eye-strain to get away with scholastic incompetence. And to conclude, Mr. Haze, our researchers are wondering about something really crucial. Now I want to ask you something. I want to know if your poor wife, or yourself, or anyone else in the family — I understand she has several aunts and a maternal grandfather in California? — oh, had! — I’m sorry — well, we all wonder if anybody in the family has instructed Dolly in the process of mammalian reproduction. Thegeneralimpressionisthatfifteen-year-oldDollyremains morbidly uninterested in sexual matters, or to be exact, represses her curiosity in order to save her ignorance and self-dignity. All right — fourteen. You see, Mr. Haze, Beardsley School does not believe in bees and blossoms, and storks and love birds, but it does believe very strongly in preparing its students for mutually satisfactory mating and successful child rearing. We feel Dolly could make excellent progress if only she Vladimir Nabokov — Lolita 129 would put her mind to her work. Miss Cormorant’s report is significantinthatrespect.Dolly is inclined to be, mildly speaking impudent. But all feel that primo, you should have your family doctor tell her the facts of life and, secundo, that you allow her to enjoy the company of her schoolmates’ brothers at the Junior Club or in Dr. Rigger’s organization, or in the lovely homes of our parents.” “She may meet boys at her own lovely home,” I said. “I hope she will,” said Pratt buoyantly. “When we questioned her about her troubles, Dolly refused to discuss the home situation, but we have spoken to some of her friends and really — well, for example, we insist you un-veto her nonparticipation in the dramatic group. You just must allow her to take part in TheHuntedEnchanters. She was such a perfect little nymph in the try-out, and sometime in spring the author will stay for a few days at Beardsley College and may attend a rehearsal or two in our new auditorium. I mean it is all part of the fun of being young and alive and beautiful. You must understand —” “I always thought of myself,” I said, “as a very understanding father.” “Oh, no doubt, no doubt, but Miss Cormorant thinks, and I am inclined to agree with her, that Dolly is obsessed by sexual thoughts for which she findsnooutlet,andwill tease and martyrize other girls, or even our younger instructors because they do have innocent dates with boys.” “Shrugged my shoulders. A shabby émigré. “Let us put our two heads together, Mr. Haze. What on earth is wrong with that child?” “She seems quite normal and happy to me,” I said (disaster coming at last? Was I found out? Had they got some hypnotist?). “What worries me,” said Miss Pratt looking at her watch and starting to go over the whole subject again, “is that both teachers and schoolmates findDollyantagonistic, dissatisfied,cagey—andeverybodywonderswhyyouaresofirmlyopposedtoallthe natural recreations of a normal child.” “Do you mean sex play?” I asked jauntily, in despair, a cornered old rat. “Well, I certainly welcome this civilized terminology,” said Pratt with a grin. “But this is not quite the point. Under the auspices of Beardsley School, dramatics, dances and other natural activities are not technically sex play, though girls do meet boys, if that is what you object to.” “All right,” I said, my hassock exhaling a weary sign. “You win. She can take part in that play. Provided male parts are taken by female parts.” “I am always fascinated,” said Pratt, “by the admirable way foreigners — or at least naturalized Americans — use our rich language. I’m sure Miss Gold, who conducts the play group, will be overjoyed. I notice she is one of the few teachers that seem to like — I mean who seem to findDollymanageable.Thistakescareofgeneraltopics,I guess; now comes a special matter. We are in trouble again.” Pratt paused truculently, then rubbed her index fingerunderhernostrilswithsuchvigor that her nose performed a kind of war dance. 130 Lolita — Vladimir Nabokov “I’m a frank person,” she said, “but conventions are conventions, and I finditdifficult…Letmeputitthisway…TheWalkers,wholiveinwhatwecallaroundherethe Duke’s Manor, you know the great gray house on the hill — they send their two girls to our school, and we have the niece of President Moore with us, a really gracious child, not to speak of a number of other prominent children. Well, under the circumstances, it is rather a jolt when Dolly, who looks like a little lady, uses words which you as a foreigner probably simply do not know or do not understand. Perhaps it might be better — Would you like me to have Dolly come up here right away to discuss things? No? You see — oh well, let’s have it out. Dolly has written a most obscene four-letter word which our Dr. Cutler tells me is low-Mexican for urinal with her lipstick on some health pamphlets which Miss Redcock, who is getting married in June, distributed among the girls, and we thought she should stay after hours — another half hour at least. But if you like —” “No,” I said, “I don’t want to interfere with rules. I shall talk to her later. I shall thrash it out.” “Do,” said the woman rising from her chair arm. “And perhaps we can get together again soon, and if things do not improve we might have Dr. Cutler analyze her.” Should I marry Pratt and strangle her? “…And perhaps your family doctor might like to examine her physically — just a routine check-up. She is in Mushroom — the last classroom along that passage.” Beardsley School, it may be explained, copied a famous girls school in England by having “traditional” nicknames for its various classrooms: Mushroom, Room-In 8, B-Room, Room-BA and so on. Mushroom was smelly, with a sepia print of Reynolds’ “Age of Innocence” above the chalkboard, and several rows of clumsy-looking pupil desks. At one of these, my Lolita was reading the chapter on “Dialogue” in Baker’s Dramatic Technique, and all was very quiet, and there was another girl with a very naked, porcelain-white neck and wonderful platinum hair, who sat in front reading too, absolutely lost to the world and interminably winding a soft curl around one finger,and I sat beside Dolly just behind that neck and that hair, and unbuttoned my overcoat and for sixty-fivecentsplusthepermissiontoparticipateintheschoolplay,hadDolly put her inky, chalky, red-knuckled hand under the desk. Oh, stupid and reckless of me, no doubt, but after the torture I had been subjected to, I simply had to take advantage of a combination that I knew would never occur again. 12 Around Christmas she caught a bad chill and was examined by a friend of Miss Lester, a Dr. Ilse Tristramson (hi, Ilse, you were a dear, uninquisitive soul, and you touched my dove very gently). She diagnosed bronchitis, patted Lo on the back (all its bloom erect because of the fever) and put her to bed for a week or longer. At firstshe“rana temperature” in American parlance, and I could not resist the exquisite caloricity of Vladimir Nabokov — Lolita 131 unexpected delights — Venus febriculosa — though it was a very languid Lolita that moaned and coughed and shivered in my embrace. And as soon as she was well again, I threw a Party with Boys. Perhaps I had drunk a little too much in preparation for the ordeal. Perhaps I made a fool of myself. Thegirlshaddecoratedandpluggedinasmallfirtree— Germancustom, except that colored bulbs had superseded wax candles. Records were chosen and fed into my landlord’s phonograph. Chic Dolly wore a nice gray dress with fitted bodice and flaredskirt.Humming,Iretiredtomystudyupstairs—andthenevery ten or twenty minutes I would come down like an idiot just for a few seconds; to pick up ostensibly my pipe from the mantelpiece or hunt for the newspaper; and with every new visit these simple actions became harder to perform, and I was reminded of the dreadfully distant days when I used to brace myself to casually enter a room in the Ramsdale house where Little Carmen was on. Thepartywasnotasuccess.Ofthethreegirlsinvited,onedidnotcomeatall,andone of the boys brought his cousin Roy, so there was a superfluityoftwoboys,andthe cousins knew all the steps, and the other fellows could hardly dance at all, and most of the evening was spent in messing up the kitchen, and then endlessly jabbering about what card game to play, and sometime later, two girls and four boys sat on the floorofthelivingroom,withallwindowsopen,andplayedawordgamewhichOpal could not be made to understand, while Mona and Roy, a lean handsome lad, drank ginger ale in the kitchen, sitting on the table and dangling their legs, and hotly discussing Predestination and the Law of Averages. After they had all gone my Lo said ugh, closed her eyes, and dropped into a chair with all four limbs starfishedtoexpress the utmost disgust and exhaustion and swore it was the most revolting bunch of boys she had ever seen. I bought her a new tennis racket for that remark. January was humid and warm, and February fooled the forsythia: none of the townspeople had ever seen such weather. Other presents came tumbling in. For her birthday I bought her a bicycle, the doe-like and altogether charming machine already mentioned — and added to this a History of Modern American Painting: her bicycle manner, I mean her approach to it, the hip movement in mounting, the grace and so on, affordedmesupremepleasure;butmyattempttorefineherpictorialtastewasa failure; she wanted to know if the guy noon-napping on Doris Lee’s hay was the father of the pseudo-voluptuous hoyden in the foreground, and could not understand why I said Grant Wood or Peter Hurd was good, and Reginald Marsh or Frederick Waugh awful. 13 By the time spring had touched up ThayerStreetwithyellowandgreenandpink,Lolita was irrevocably stage-struck. Pratt, whom I chanced to notice one Sunday lunching with some people at Walton Inn, caught my eye from afar and went through 132 Lolita — Vladimir Nabokov the motion of sympathetically and discreetly clapping her hands while Lo was not looking. I detest the theatre as being a primitive and putrid form, historically speaking; a form that smacks of stone-age rites and communal nonsense despite those individual injections of genius, such as, say, Elizabethan poetry which a closeted reader automatically pumps out of the stuff.Beingmuchoccupiedatthetimewithmyownliterary labors, I did not bother to read the complete text of TheEnchantedHunters, the playlet in which Dolores Haze was assigned the part of a farmer’s daughter who imagines herself to be a woodland witch, or Diana, or something, and who, having got hold of a book on hypnotism, plunges a number of lost hunters into various entertaining trances before falling in her turn under the spell of a vagabond poet (Mona Dahl). ThatmuchIgleanedfrombitsofcrumpledandpoorlytypedscriptthatLosowed all over the house. Thecoincidenceofthetitlewiththenameofanunforgettable inn was pleasant in a sad little way: I wearily thought I had better not bring it to my own enchantress’s notice, lest a brazen accusation of mawkishness hurt me even more than her failure to notice it for herself had done. I assumed the playlet was just another, practically anonymous, version of some banal legend. Nothing prevented one, of course, from supposing that in quest of an attractive name the founder of the hotel had been immediately and solely influencedbythechancefantasyofthesecond-ratemuralist he had hired, and that subsequently the hotel’s name had suggested the play’s title. But in my credulous, simple, benevolent mind I happened to twist it the other way round, and without giving the whole matter much though really, supposed that mural, name and title had all been derived from a common source, from some local tradition, which I, an alien unversed in New England lore, would not be supposed to know. In consequence I was under the impression (all this quite casually, you understand, quite outside my orbit of importance) that the accursed playlet belonged to the type of whimsy for juvenile consumption, arranged and rearranged many times, such as Hansel and Gretel by Richard Roe, or TheSleepingBeautyby Dorothy Doe, or TheEmperor’sNewClothes by Maurice Vermont and Marion Rumpelmeyer — all this to be found in any Plays for School Actors or Let’s Have a Play! In other words, I did not know — and would not have cared, if I did — that actually TheEnchantedHunters was a quite recent and technically original composition which had been produced for the firsttimeonlythreeorfourmonthsagobyahighbrowgroupinNewYork.Tome — inasmuch as I could judge from my charmer’s part — it seemed to be a pretty dismal kind of fancy work, with echoes from Lenormand and Maeterlinck and various quiet British dreamers. Thered-capped,uniformlyattiredhunters,ofwhichonewasa banker, another a plumber, a third a policeman, a fourth an undertaker, a fifthanunderwriter, a sixth an escaped convict (you see the possibilities!), went through a complete change of mind in Dolly’s Dell, and remembered their real lives only as dreams or nightmares from which little Diana had aroused them; but a seventh Hunter (in a green cap, the fool) was a Young Poet, and he insisted, much to Diana’s annoyance, that she and the entertainment provided (dancing nymphs, and elves, and monsters) were his, the Poet’s, invention. I understand that finally,inutterdisgustathiscockVladimir Nabokov — Lolita 133 sureness, barefooted Dolores was to lead check-trousered Mona to the paternal farm behind the Perilous Forest to prove to the braggart she was not a poet’s fancy, but a rustic, down-to-brown-earth lass — and a last-minute kiss was to enforce the play’s profound message, namely, that mirage and reality merge in love. I considered it wiser not to criticize the thing in front of Lo: she was so healthily engrossed in “problems of expression,” and so charmingly did she put her narrow Florentine hands together, batting her eyelashes and pleading with me not to come to rehearsals as some ridiculous parents did because she wanted to dazzle me with a perfect First Night — and because I was, anyway, always butting in and saying the wrong thing, and cramping her style in the presence of other people. Therewasoneveryspecialrehearsal…myheart,myheart…therewasonedayinMay marked by a lot of gay flurry—itallrolledpast,beyondmyken,immunetomymemory, and when I saw Lo next, in the late afternoon, balancing on her bike, pressing the palm of her hand to the damp bark of a young birch tree on the edge of our lawn, I was so struck by the radiant tenderness of her smile that for an instant I believed all our troubles gone. “Can you remember,” she said, “what was the name of that hotel, you know [nose puckered], come on, you know — with those white columns and the marble swan in the lobby? Oh, you know [noisy exhalation of breath] — the hotel where you raped me. Okay, skip it. I mean, was it [almost in a whisper] TheEnchanted Hunters? Oh, it was? [musingly] Was it?” — and with a yelp of amorous vernal laughter she slapped the glossy bole and tore uphill, to the end of the street, and then rode back, feet at rest on stopped pedals, posture relaxed, one hand dreaming in her print-floweredlap. 14 Because it supposedly tied up with her interest in dance and dramatics, I had permitted Lo to take piano lessons with a Miss Emperor (as we French scholars may conveniently call her) to whose blue-shuttered little white house a mile or so beyond Beardsley Lo would spin offtwiceaweek.OneFridaynighttowardtheendof May (and a week or so after the very special rehearsal Lo had not had me attend) the telephone in my study, where I was in the act of mopping up Gustave’s — I mean Gaston’s — king’s side, rang and Miss Emperor asked if Lo was coming next Tuesday because she had missed last Tuesday’s and today’s lessons. I said she would by all means — and went on with the game. As the reader may well imagine, my faculties were now impaired, and a move or two later, with Gaston to play, I noticed through the filmofmygeneraldistressthathecouldcollectmyqueen;henoticedittoo,butthinking it might be a trap on the part of his tricky opponent, he demurred for quite a minute, and puffedandwheezed,andshookhisjowls,andevenshotfurtiveglancesat me, and made hesitating half-thrusts with his pudgily bunched fingers—dyingtotake that juicy queen and not daring — and all of a sudden he swooped down upon 134 Lolita — Vladimir Nabokov it (who knows if it did not teach him certain later audacities?), and I spent a dreary hour in achieving a draw. He finishedhisbrandyandpresentlylumberedaway,quitesatisfiedwiththisresult(mon pauvre ami, je ne vous ai jamais revu et quoiqu’il y ait bien peu de chance que vous voyiez mon livre, permettez-moi de vous dire que je vous serre la main bien cordialement, et que toutes mes fillettesvoussaluent). I found Dolores Haze at the kitchen table, consuming a wedge of pie, with her eyes fixedonherscript.Theyrose to meet mine with a kind of celestial vapidity. She remained singularly unruffledwhen confronted with my discovery, and said d’un petit air faussement contrit that she knew she was a very wicked kid, but simply had not been able to resist the enchantment, and had used up those music hours — O Reader, My Reader! — in a nearby public park rehearsing the magic forest scene with Mona. I said “fine”—andstalkedtothe telephone. Mona’s mother answered: “Oh yes, she’s in” and retreated with a mother’s neutral laugh of polite pleasure to shout offstage“Roycalling!”andtheverynextmoment Mona rustled up, and forthwith, in a low monotonous not untender voice started berating Roy for something he had said or done and I interrupted her, and presently Mona was saying in her humbles, sexiest contralto, “yes, sir,” “surely, sir” “I am alone to blame, sir, in this unfortunate business,” (what elocution! what poise!) “honest, I feel very bad about it” — and so on and so forth as those little harlots say. So downstairs I went clearing my throat and holding my heart. Lo was now in the living room, in her favorite overstuffedchair.Asshesprawledthere,bitingata hangnail an mocking me with her heartless vaporous eyes, and all the time rocking a stool upon which she had placed the heel of an outstretched shoeless foot, I perceived all at once with a sickening qualm how much she had changed since I firstmet her two years ago. Or had this happened during those last two weeks? Tendresse? Surely that was an exploded myth. She sat right in the focus of my incandescent anger. Thefogofalllusthadbeensweptawayleavingnothingbutthisdreadfullucidity.Oh,she had changed! Her complexion was now that of any vulgar untidy highschool girl who applies shared cosmetics with grubby fingerstoanunwashedfaceanddoesnotmind what soiled texture, what pustulate epidermis comes in contact with her skin. Its smooth tender bloom had been so lovely in former days, so bright with tears, when I used to roll, in play, her tousled head on my knee. A coarse flushhadnowreplacedthat innocent fluorescence.Whatwaslocallyknownasa“rabbitcold”hadpaintedwith flamingpinktheedgesofhercontemptuousnostrils.AsinterrorIloweredmygaze, it mechanically slid along the underside of her tensely stretched bare thigh — how polished and muscular her legs had grown! She kept her wide-set eyes, clouded-glass gray and slightly bloodshot, fixeduponme,andIsawthestealthythoughtshowingthrough them that perhaps after all Mona was right, and she, orphan Lo, could expose me without getting penalized herself. How wrong I was. How mad I was! Everything about her was of the same exasperating impenetrable order — the strength of her shapely legs, the dirty sole of her white sock, the thick sweater she wore despite the closeness of the room, her wenchy smell, and especially the dead end of her face with its strange flushandfreshlymade-uplips.Someoftheredhadleftstains Vladimir Nabokov — Lolita 135 on her front teeth, and I was struck by a ghastly recollection — the evoked image not of Monique, but of another young prostitute in a bell-house, ages ago, who had been snapped up by somebody else before I had time to decide whether her mere youth warranted my risking some appalling disease, and who had just such flushedprominent pommettes and a dead maman, and big front teeth, and a bit of dingy red ribbon in her country-brown hair. “Well, speak,” said Lo. “Was the corroboration satisfactory?” “Oh, yes,” I said. “Perfect. yes. And I do not doubt you two made it up. As a matter of fact, I do not doubt you have told her everything about us.” “Oh, yah?” I controlled my breath and said: “Dolores, this must stop right away. I am ready to yank you out of Beardsley and lock you up you know where, but this must stop. I am ready to take you away the time it takes to pack a suitcase. Thismuststoporelseanything may happen.” “Anything may happen, huh?” I snatched away the stool she was rocking with her heel and her foot fell with a thud on the floor. “Hey,” she cried, “take it easy.” “First of all you go upstairs,” I cried in my turn, — and simultaneously grabbed at her and pulled her up. From that moment, I stopped restraining my voice, and we continued yelling at each other, and she said, unprintable things. She said she loathed me. She made monstrous faces at me, inflatinghercheeksandproducingadiabolical plopping sound. She said I had attempted to violate her several times when I was her mother’s roomer. She said she was sure I had murdered her mother. She said she would sleep with the very firstfellowwhoaskedherandIcoulddonothingaboutit.I said she was to go upstairs and show me all her hiding places. It was a strident and hateful scene. I held her by her knobby wrist and she kept turning and twisting it this way and that, surreptitiously trying to findaweakpointsoastowrenchherselffreeat a favorable moment, but I held her quite hard and in fact hurt her rather badly for which I hope my heart may rot, and once or twice she jerked her arm so violently that I feared her wrist might snap, and all the while she stared at me with those unforgettable eyes where could anger and hot tears struggled, and our voices were drowning the telephone, and when I grew aware of its ringing she instantly escaped. With people in movies I seem to share the services of the machina telephonica and its sudden god. Thistimeitwasanirateneighbor.Theeastwindowhappenedtobe agape in the living room, with the blind mercifully down, however; and behind it the damp black night of a sour New England spring had been breathlessly listening to us. I had always thought that type of haddocky spinster with the obscene mind was the result of considerable literary inbreeding in modern fiction;butnowIamconvinced that prude and prurient Miss East — or to explode her incognito, Miss Fenton Lebone — had been probably protruding three-quarter-way from her bedroom window as she strove to catch the gist of our quarrel. 136 Lolita — Vladimir Nabokov “…Thisracket…lacksallsenseof…”quackedthereceiver,“wedonotliveinatenement here. I must emphatically…” I apologized for my daughter’s friends being so loud. Young people, you know — and cradled the next quack and a half. Downstairs the screen door banged. Lo? Escaped? ThroughthecasementonthestairsIsawasmallimpetuousghostslipthroughthe shrubs; a silvery dot in the dark — hub of the bicycle wheel — moved, shivered, and she was gone. It so happened that the car was spending the night in a repair shop downtown. I had no other alternative than to pursue on foot the winged fugitive. Even now, after more than three years have heaved and elapsed, I cannot visualize that spring-night street, that already so leafy street, without a gasp of panic. Before their lighted porch Miss Lester was promenading Miss Fabian’s dropsical dackel. Mr. Hyde almost knocked it over. Walk three steps and runt three. A tepid rain started to drum on the chestnut leaves. At the next corner, pressing Lolita against an iron railing, a blurred youth held and kissed — no, not her, mistake. My talons still tingling, I flewon. Half a mile or so east of number fourteen, ThayerStreettangleswithaprivatelaneand a cross street; the latter leads to the town proper; in front of the firstdrugstore,I saw — with what melody of relief! — Lolita’s fair bicycle waiting for her. I pushed instead of pulling, pulled, pushed, pulled, and entered. Look out! some ten paces away Lolita, though the glass of a telephone booth (membranous god still with us), cupping the tube, confidentiallyhunchedoverit,slithereyesatme,turnedawaywithhertreasure, hurriedly hung up, and walked out with a flourish. “Tried to reach you at home,” she said brightly. “A great decision has been made. But firstbuymeadrink,dad.” She watched the listless pale fountain girl put in the ice, pour in the coke, add the cherry syrup — and my heart was bursting with love-ache. Thatchildishwrist.Mylovely child. You have a lovely child, Mr. Humbert. We always admire her as she passes by. Mr. Pim watched Pippa suck in the concoction. J’ai toujours admiré l’oeuvre du sublime Dublinois. And in the meantime the rain had become a voluptuous shower. “Look,” she said as she rode the bike beside me, one foot scraping the darkly glistening sidewalk, “look, I’ve decided something. I want to leave school I hate that school I hate the play, I really do! Never go back. Find another. Leave at once. Go for a long trip again. But this time we’ll go wherever I want, won’t we?” I nodded. My Lolita. “I choose? C’est entendu?” she asked wobbling a little beside me. Used French only when she was a very good little girl. “Okay. Entendu. Now hop-hop-hop, Lenore, or you’ll get soaked.” (A storm of sobs was fillingmychest.) She bared her teeth and after her adorable school-girl fashioned, leaned forward, and away she sped, my bird. Vladimir Nabokov — Lolita 137 Miss Lester’s finelygroomedhandheldaporch-dooropenforawaddlingolddog qui prenait son temps. Lo was waiting for me near the ghostly birch tree. “I am drenched,” she declared at the top of her voice. “Are you glad? To hell with the play! See what I mean?” An invisible hag’s claw slammed down an upper-floorwindow. In our hallway, ablaze with welcoming lights, my Lolita peeled offhersweater,shook her gemmed hair, stretched towards me two bare arms, raised one knee: “Carry me upstairs, please. I feel sort of romantic tonight.” It may interest physiologists to learn, at this point, that I have the ability — a most singular case, I presume — of shedding torrents of tears throughout the other tempest. 15 Thebrakeswererelined,thewaterpipesunclogged,thevalvesground,andanumberof other repairs and improvements were paid for by not very mechanically-minded but prudent papa Humbert, so that the late Mrs. Humbert’s car was in respectable shape when ready to undertake a new journey. We had promised Beardsley School, good old Beardsley School, that we would be back as soon as my Hollywood engagement came to an end (inventive Humbert was to be, I hinted, chief consultant in the production of a filmdealingwith“existentialism,” still a hot thing at the time). Actually I was toying with the idea of gently trickling across the Mexican border — I was braver now than last year — and there deciding what to do with my little concubine who was now sixty inches tall and weighed ninety pounds. We had dug out our tour books and maps. She had traced our route with immense zest. Was it thanks to those theatricals that she had now outgrown her juvenile jaded airs and was so adorably keen to explore rich reality? I experienced the queer lightness of dreams that pale but warm Sunday morning when we abandoned Professor Chem’s puzzled house and sped along Main Street toward the four-lane highway. My Love’s striped, black-and-white cotton frock, jaunty blue with the large beautifully cut aquamarine on a silver chainlet, which gemmed her throat: a spring rain gift from me. We passed the New Hotel, and she laughed. “A penny for your thoughts,” I said and she stretched out her palm at once, but at that moment I had to apply the breaks rather abruptly at a red light. As we pulled up, another car came to a gliding stop alongside, and a very striking looking, athletically lean young woman (where had I seen her?) with a high complexion and shoulder-length brilliant bronze hair, greeted Lo with a ringing “Hi!” — and then, addressing me, effusively,edusively(placed!),stressingcertainwords,said:“Whata shame to was to tear Dolly away from the play — you should have heard the author raving about her after that rehearsal —” “Green light, you dope,” said Lo under her 138 Lolita — Vladimir Nabokov breath, and simultaneously, waving in bright adieu a bangled arm, Joan of Arc (in a performance we saw at the local theatre) violently outdistanced us to swerve into Campus Avenue. “Who was it exactly? Vermont or Rumpelmeyer?” “No — Edusa Gold — the gal who coaches us.” “I was not referring to her. Who exactly concocted that play?” “Oh! Yes, of course. Some old woman, Clare Something, I guess. Therewasquitea crowd of them there.” “So she complimented you?” “Complimented my eye — she kissed me on my pure brow” — and my darling emitted that new yelp of merriment which — perhaps in connection with her theatrical mannerisms — she had lately begun to affect. “You are a funny creature, Lolita,” I said — or some such words. “Naturally, I am overjoyed you gave up that absurd stage business. But what is curious is that you dropped the whole thing only a week before its natural climax. Oh, Lolita, you should be careful of those surrenders of yours. I remember you gave up Ramsdale for camp, and camp for a joyride, and I could list other abrupt changes in your disposition. You must be careful. Therearethingsthatshouldneverbegivenup.Youmustpersevere. You should try to be a little nicer to me, Lolita. You should also watch your diet. Thetourofyourthigh,youknow,shouldnotexceedseventeenandahalfinches.More might be fatal (I was kidding, of course). We are now setting out on a long happy journey. I remember —” 16 I remember as a child in Europe gloating over a map of North America that had “Appalachian Mountains” boldly running from Alabama up to New Brunswick, so that the whole region they spanned — Tennessee, the Virginias, Pennsylvania, New York, Vermont, New Hampshire and Maine, appeared to my imagination as a gigantic Switzerland or even Tibet, all mountain, glorious diamond peak upon peak, giant conifers, le montagnard émigré in his bear skin glory, and Felis tigris goldsmithi, and Red Indians under the catalpas. Thatitallboileddowntoameaslysuburban lawn and a smoking garbage incinerator, was appalling. Farewell, Appalachia! Leaving it, we crossed Ohio, the three states beginning with “I,” and Nebraska — ah, that firstwhiffoftheWest!Wetraveledveryleisurely,havingmorethana weektoreach Wace, Continental Divide, where she passionately desired to see he Ceremonial Dances marking the seasonal opening of Magic Cave, and at least three weeks to reach Elphinstone, gem of a western State where she yearned to climb Red Rock from which a mature screen star had recently jumped to her death after a drunken row with her gigolo. Again we were welcomed to wary motels by means of inscriptions that read: Vladimir Nabokov — Lolita 139 “We wish you feel at home while here. All equipment was carefully checked upon your arrival. Your license number is on record here. Use hot water sparingly. We reserve the right to eject without notice any objectionable person. Do not throw waste material of any kind in the toilet bowl. Thankyou.Callagain.TheManagement.P.S.We consider our guests the Finest People of the World.” In these frightening places we paid ten for twins, fliesqueuedoutsideatthescreenless door and successfully scrambled in, the ashes of our predecessors still lingered in the ashtrays, a woman’s hair lay on the pillow, one heard one’s neighbor hanging his coat in his closet, the hangers were ingeniously fixedtotheirbarsbycoilsofwiresoasto thwart theft, and, in crowning insult, the pictures above the twin beds were identical twins. I also noticed that commercial fashion was changing. Therewasatendencyfor cabins to fuse and gradually form the caravansary, and, lo (she was not interested but the reader may be), a second story was added, and a lobby grew in, and cars were removed to a communal garage, and the motel reverted to the good old hotel. I now warn the reader not to mock me and my mental daze. It is easy for him and me to decipher now a past destiny; but a destiny in the making is, believe me, not one of those honest mystery stories where all you have to do is keep an eye on the clues. In my youth I once read a French detective tale where the clues were actually in italics; but that is not McFate’s way — even if one does learn to recognize certain obscure indications. For instance: I would not swear that there was not at least one occasion, prior to, or at the very beginning of, the Midwest lap of our journey, when she managed to convey some information to, or otherwise get into contact with, a person or persons unknown. We had stopped at a gas station, under the sign of Pegasus, and she had slipped out of her seat and escaped to the rear of the premises while the raised hood, under which I had bent to watch the mechanic’s manipulations, hid her for a moment from my sight. Being inclined to be lenient, I only shook my benign head though strictly speaking such visits were taboo, since I felt instinctively that toilets — as also telephones — happened to be, for reasons unfathomable, the points where my destiny was liable to catch. We all have such fateful objects — it may be a recurrent landscape in one case, a number in another — carefully chosen by the gods to attract events of special significanceforus:hereshallJohnalwaysstumble;thereshallJane’sheartalways break. Well — my car had been attended to, and I had moved it away from the pumps to let a pickup truck be serviced — when the growing volume of her absence began to weigh upon me in the windy grayness. Not for the firsttime,andnotforthelast,hadI stared in such dull discomfort of mind at those stationary trivialities that look almost surprised, like staring rustics, to findthemselvesinthestrandedtraveler’sfieldofvision: that green garbage can, those very black, very whitewalled tires for sale, those bright cans of motor oil, that red icebox with assorted drinks, the four, five,sevendiscarded bottles within the incompleted crossword puzzle of their wooden cells, that bug patiently walking up the inside of the window of the office.Radiomusicwascom140 Lolita — Vladimir Nabokov ing from its open door, and because the rhythm was not synchronized with the heave and flutterandothergesturesofwind-animatedvegetation,onehadtheimpressionof an old scenic filmlivingitsownlifewhilepianoorfiddlefolloweda lineofmusicquite outside the shivering flower,theswayingbranch.ThesoundofCharlotte’slastsob incongruously vibrated through me as, with her dress flutteringathwarttherhythm,Lolita veered from a totally unexpected direction. She had found the toilet occupied and had crossed over to the sign of the Conche in the next block. Theysaidtheretheywere proud of their home-clean restrooms. Theseprepaidpostcards,theysaid,hadbeenprovided for your comments. No postcards. No soap. Nothing. No comments. Thatdayorthenext,afteratediousdrivethroughalandoffoodcrops,wereacheda pleasant little burg and put up at Chestnut Court — nice cabins, damp green grounds, apple trees, an old swing — and a tremendous sunset which the tried child ignored. She had wanted to go through Kasbeam because it was only thirty miles north from her home town but on the following morning I found her quite listless, with no desire to see again the sidewalk where she had played hopscotch some fiveyearsbefore.Forobvious reasons I had rather dreaded that side trip, even though we had agreed not to make ourselves conspicuous in any way — to remain in the car and not look up old friends. My relief at her abandoning the project was spoiled by the thought that had she felt I were totally against the nostalgic possibilities of Pisky, as I had been last year, she would not have given up so easily. On my mentioning this with a sigh, she sighed too and complained of being out of sorts. She wanted to remain in bed till teatime at least, with lots of magazines, and then if she felt better she suggested we just continue westward. I must say she was very sweet and languid, and craved for fresh fruits, and I decided to go and fetch her a toothsome picnic lunch in Kasbeam. Our cabin stood on the timbered crest of a hill, and from our window you could see the road winding down, and then running as straight as a hair parting between two rows of chestnut trees, towards the pretty town, which looked singularly distinct and toylike in the pure morning distance. One could make out an elf-like girl on an insect-like bicycle, and a dog, a bit too large proportionately, all as clear as those pilgrims and mules winding up wax-pale roads in old paintings with blue hills and red little people. I have the European urge to use my feet when a drive can be dispensed with, so I leisurely walked down, eventually meeting the cyclist — a plain plump girl with pigtails, followed by a huge St. Bernard dog with orbits like pansies. In Kasbeam a very old barber gave me a very mediocre haircut: he babbled of a baseball-playing son of his, and, at every explodent, spat into my neck, and every now and then wiped his glasses on my sheet-wrap, or interrupted his tremulous scissor work to produce faded newspaper clippings, and so inattentive was I that it came as a shock to realize as he pointed to an easeled photograph among the ancient gray lotions, that the mustached young ball player had been dead for the last thirty years. I had a cup of hot flavorlesscoffee,boughta bunchofbananasformymonkey,and spent another ten minutes or so in a delicatessen store. At least an hour and a half must have elapsed when this homeward-bound little pilgrim appeared on the winding road leading to Chestnut Castle. Vladimir Nabokov — Lolita 141 ThegirlIhadseenonmywaytotownwasnowloadedwithlinenandengagedin helping a misshapen man whose big head and coarse features reminded me of the “Bertoldo” character in low Italian comedy. Theywerecleaningthecabinsofwhich there was a dozen or so on Chestnut Crest, all pleasantly spaced amid the copious verdure. It was noon, and most of them, with a finalbangoftheirscreendoors,had already got rid of their occupants. A very elderly, almost mummy-like couple in a very new model were in the act of creeping out of one of the contiguous garages; from another a red hood protruded in somewhat cod-piece fashion; and nearer to our cabin, a strong and handsome young man with a shock of black hair and blue eyes was putting a portable refrigerator into a station wagon. For some reason he gave me a sheepish grin as I passed. On the grass expanse opposite, in the many-limbed shade of luxuriant trees, the familiar St. Bernard dog was guarding his mistress’ bicycle, and nearby a young woman, far gone in the family way, had seated a rapt baby on a swing and was rocking it gently, while a jealous boy of two or three was making a nuisance of himself by trying to push or pull the swing board; he finallysucceededingettinghimself knocked down by it, and bawled loudly as he lay supine on the grass while his mother continued to smile gently at neither of her present children. I recall so clearly these minutiae probably because I was to check my impressions so thoroughly only a few minutes later; and besides, something in me had been on guard ever since that awful night in Beardsley. I now refused to be diverted by the feeling of well-being that my walk had engendered — by the young summer breeze that enveloped the nape of my neck, the giving crunch of the damn gravel, the juice tidbit. I had sucked out at last from a hollow tooth, and even the comfortable weight of my provisions which the general condition of my heart should not have allowed me to carry; but even that miserable pump of mine seemed to be working sweetly, and I felt adolori d’amoureuse langueur, to quote dear old Ronsard, as I reached the cottage where I had left my Dolores. To my surprise I found her dressed. She was sitting on the edge of the bed in slacks and T-shirt, and was looking at me as if she could not quite place me. Thefranksoft shape of her small breasts was brought out rather than blurred by the limpness of her thin shirt, and this frankness irritated me. She had not washed; yet her mouth was freshly though smudgily painted, and her broad teeth glistened like wine-tinged ivory, or pinkish poker chips. And there she sat, hands clasped in her lap, and dreamily brimmed with a diabolical glow that had no relations to me whatever. I plumped down my heavy paper bag and stood staring at the bare ankles of her sandaled feet, then at her silly face, then again at her sinful feet. “You’ve been out,” I said (the sandals were filthywithgravel). “I just got up,” she replied, and added upon intercepting my downward glance: “Went out for a sec. Wanted to see if you were coming back.” She became aware of the bananas and uncoiled herself tableward. What special suspicion could I have? None indeed — but those muddy, moony eyes of hers, that singular warmth emanating from her! I said nothing. I looked at the road 142 Lolita — Vladimir Nabokov meandering so distinctly within the frame of the window… Anybody wishing to betray my trust would have found it a splendid lookout. With rising appetite, Lo applied herself to the fruit. All at once I remembered the ingratiating grin of the Johnny next door. I stepped out quickly. All cars had disappeared except his station wagon; his pregnant young wife was not getting into it with her baby and the other, more or less canceled, child. “What’s the matter, where are you going?” cried Lo from the porch. I said nothing. I pushed her softness back into the room and went in after her. I ripped her shirt off.Iunzippedtherestofher,Itoreoffhersandals.Wildly,I pursued the shadow of her infidelity;butthescentItraveleduponwassoslightastobepractically undistinguishable from a madman’s fancy. 17 Gros Gaston, in his prissy way, had liked to make presents — presents just a prissy wee bit out of the ordinary, or so he prissily thought. Noticing one night that my box of chessmen was broken, he sent me next morning, with a little lad of his, a copper case: it had an elaborate Oriental design over the lid and could be securely locked. Once glance sufficedtoassuremethatitwasoneofthosecheapmoneyboxescalledforsome reason “luizettas” that you buy in Algiers and elsewhere, and wonder what to do with afterwards. It turned out to be much too flatforholdingmybulkychessmen,but I kept it — using it for a totally differentpurpose. In order to break some pattern of fate in which I obscurely felt myself being enmeshed, I had decided — despite Lo’s visible annoyance — to spend another night at Chestnut Court; definitelywakingupatfourinthemorning,IascertainedthatLowas still sound asleep (mouth open, in a kind of dull amazement at the curiously inane life we all had rigged up for her) and satisfiedmyselfthatthepreciouscontentsofthe “luizetta” were safe. There,snuglywrappedinawhitewoolenscarf,layapocketautomatic: caliber .32, capacity of magazine 8 cartridges, length a little under one ninth of Lolita’s length, stock checked walnut, finishfullblued.Ihadinheriteditfromthe late Harold Haze, with a ?938 catalog which cheerily said in part: “Particularly well adapted for use in the home and car as well as on the person.” Thereitlay,readyforinstant service on the person or persons, loaded and fully cocked with the slide lock in safety position, thus precluding any accidental discharge. We must remember that a pistol is the Freudian symbol of the Ur-father’s central forelimb. I was now glad I had it with me — and even more glad that I had learned to use it two years before, in the pine forest around my and Charlotte’s glass lake. Farlow, with whom I had roamed those remote woods, was an admirable marksman, and with his .38 actually managed to hit a hummingbird, though I must say not much of it could be retrieved for proof — only a little iridescent fluff.A burleyex-policemancalledKrestovski, who in the twenties had shot and killed two escaped convicts, joined us and Vladimir Nabokov — Lolita 143 bagged a tiny woodpecker — completely out of season, incidentally. Between those two sportsmen I of course was a novice and kept missing everything, though I did would a squirrel on a later occasion when I went out alone. “You like here,” I whispered to my light-weight compact little chum, and then toasted it with a dram of gin. 18 ThereadermustnowforgetChestnutsandColts,andaccompanyusfurtherwest.Thefollowingdaysweremarkedbyanumberofgreatthunderstorms—orperhaps,thee was but one single storm which progressed across country in ponderous frogleaps and which we could not shake offjustaswecouldnotshakeoffdetectiveTrapp:forit was during those days that the problem of the Aztec Red Convertible presented itself to me, and quite overshadowed the theme of Lo’s lovers. Queer! I who was jealous of every male we met — queer, how I misinterpreted the designations of doom. Perhaps I had been lulled by Lo’s modest behavior in winter, and anyway it would have been too foolish even for a lunatic to suppose another Humbert was avidly following Humbert and Humbert’s nymphet with Jovian fireworks, over the great and ugly plains. I surmised, donc, that the Red Yak keeping behind us at a discreet distance mile after mile was operated by a detective whom some busybody had hired to see what exactly Humbert Humbert was doing with that minor stepdaughter of his. As happens with me at periods of electrical disturbance and crepitating lightnings, I had hallucinations. Maybe they were more than hallucinations. I do not know what she or he, or both had put into my liquor but one night I felt sure somebody was tapping on the door of our cabin, and I flungitopen,andnoticed two things — that I was stark naked and that, white-glistening in the rain-dripping darkness, there stood a man holding before his face the mask of Jutting Chin, a grotesque sleuth in the funnies. He emitted a muffledguffawandscurriedaway,andI reeled back into the room, and fell asleep again, and am not sure even to this day that the visit was not a drug-provoked dream: I have thoroughly studied Trapp’s type of humor, and this might have been a plausible sample. Oh, crude and absolutely ruthless! Somebody, I imagined, was making money on those masks of popular monsters and morons. Did I see next morning two urchins rummaging in a garbage can and trying on Jutting Chin? I wonder. It may all have been a coincidence — due to atmospheric conditions, I suppose. Being a murderer with a sensational but incomplete and unorthodox memory, I cannot tell you, ladies and gentlemen, the exact day when I firstknewwithuttercertainty that the red convertible was following us. I do remember, however, the firsttime I saw its driver quite clearly. I was proceeding slowly one afternoon through torrents of rain and kept seeing that red ghost swimming and shivering with lust in my mirror, when presently the deluge dwindled to a patter, and then was suspended altogether. With a swishing sound a sunburst swept the highway, and needing a pair of 144 Lolita — Vladimir Nabokov new sunglasses, I pulled up at a fillingstation.Whatwashappeningwasasickness,a cancer, that could not be helped, so I simply ignored the fact that our quiet pursuer, in his converted state, stopped a little behind us at a café or bar bearing the idiotic sign: TheBustle:ADeceitfulSeatful.Havingseentotheneedsofmycar,Iwalkedinto the officetogetthoseglassesandpayforthegas.AsI wasintheactofsigninga traveler’s check and wondered about my exact whereabouts, I happened to glance through a side window, and saw a terrible thing. A broad-backed man, baldish, in an oatmeal coat and dark-brown trousers, was listening to Lo who was leaning out of the car and talking to him very rapidly, her hand with outspread fingersgoingupanddown as it did when she was very serious and emphatic. What struck me with sickening force was — how should I put it? — the voluble familiarity of her way, as if they had known each other — oh, for weeks and weeks. I saw him scratch his cheek and nod, and turn, and walk back to his convertible, a broad and thickish man of my age, somewhat resembling Gustave Trapp, a cousin of my father’s in Switzerland — same smoothly tanned face, fuller than mine, with a small dark mustache and a rosebud degenerate mouth. Lolita was studying a road map when I got back into the car. “What did that man ask you, Lo?” “Man? Oh, that man. Oh yes. Oh, I don’t know. He wondered if I had a map. Lost his way, I guess.” We drove on, and I said: “Now listen, Lo. I do not know whether you are lying or not, and I do not know whether you are insane or not, and I do not care for the moment; but that person has been following us all day, and his car was at the motel yesterday, and I think he is a cop. You know perfectly well what will happen and where you will go if the police findoutaboutthings.NowIwanttoknowexactlywhathesaidtoyouandwhatyou told him.” She laughed. “If he’s really a cop,” she said shrilly but not illogically, “the worst thing we could do, would be to show him we are scared. Ignore him, Dad.” “Did he ask where we were going?” “Oh, he knows that” (mocking me). “Anyway,” I said, giving up, “I have seen his face now. He is not pretty. He looks exactly like a relative of mine called Trapp.” “Perhaps he is Trapp. If I were you — Oh, look, all the nines are changing into the next thousand. When I was a little kid,” she continued unexpectedly, “I used to think they’d stop and go back to nines, if only my mother agreed to put the car in reverse.” It was the firsttime,Ithink,shespokespontaneouslyofherpre-Humbertianchildhood; perhaps, the theatre had taught her that trick; and silently we traveled on, unpursued. But next day, like pain in a fatal disease that comes back as the drug and hope wear off,thereitwasagainbehindus,thatglossyredbeast.Thetrafficonthe highway Vladimir Nabokov — Lolita 145 was light that day; nobody passed anybody; and nobody attempted to get in between our humble blue car and its imperious red shadow — as if there were some spell cast on that interspace, a zone of evil mirth and magic, a zone whose very precision and stability had a glass-like virtue that was almost artistic. Thedriverbehindme,withhis stuffedshouldersandTrappishmustache,lookedlikeadisplaydummy,andhisconvertible seemed to move only because an invisible rope of silent silk connected it with out shabby vehicle. We were many times weaker than his splendid, lacquered machine, so that I did not even attempt to outspeed him. O lente currite noctis equi! O softly run, nightmares! We climbed long grades and rolled downhill again, and heeded speed limits, and spared slow children, and reproduced in sweeping terms the black wiggles of curves on their yellow shields, and no matter how and where we drove, the enchanted interspace slid on intact, mathematical, mirage-like, the viatic counterpart of a magic carpet. And all the time I was aware of a private blaze on my right: her joyful eye, her flamingcheek. A trafficpoliceman,deepinthenightmareofcrisscrossstreets— athalf-past-fourp.m. in a factory town — was the hand of chance that interrupted the spell. He beckoned me on, and then with the same hand cut offmyshadow.Ascoreofcarswerelaunched in between us, and I sped on, and deftly turned into a narrow lane. A sparrow alighted with a jumbo bread crumb, was tackled by another, and lost the crumb. When after a few grim stoppages and a bit of deliberate meandering, I returned to the highway, our shadow had disappeared. Lola snorted and said: “If he is what you think he is, how silly to give him the slip.” “I have other notions by now,” I said. “You should — ah — check them by — ah — keeping in touch with him, fahther deah,” said Lo, writhing in the coils of her own sarcasm. “Gee, you are mean,” she added in her ordinary voice. We spent a grim night in a very foul cabin, under a sonorous amplitude of rain, and with a kind of prehistorically loud thunder incessantly rolling above us. “I am not a lady and do not like lightning,” said Lo, whose dread of electric storms gave me some pathetic solace. We had breakfast in the township of Soda, pop. ?00?. “Judging by the terminal figure,”Iremarked,“Fatfaceisalreadyhere.” “Your humor,” said Lo, “is sidesplitting, deah fahther.” We were in sage-brush country by that time, and there was a day or two of lovely release (I had been a fool, all was well, that discomfort was merely a trapped flatus),and presently the mesas gave way to real mountains, and, on time, we drove into Wace. Oh, disaster. Some confusion had occurred, she had misread a date in the Tour Book, and the Magic Cave ceremonies were over! She took it bravely, I must admit — and, when we discovered there was in kurortish Wace a summer theatre in full swing, we naturally drifted toward it one fair mid-June evening. I really could not tell 146 Lolita — Vladimir Nabokov you the plot of the play we saw. A trivial affair,nodoubt,withself-consciouslighteffects and a mediocre leading lady. Theonlydetailthatpleasedmewasagarlandofseven little graces, more or less immobile, prettily painted, barelimbed — seven bemused pubescent girls in colored gauze that had been recruited locally (judging by the partisan flurryhereandthereamongtheaudience)andweresupposedtorepresenta living rainbow, which lingered throughout the last act, and rather teasingly faded behind a series of multiplied veils. I remember thinking that this idea of children-colors had been lifted by authors Clare Quilty and Vivian Darkbloom from a passage in James Joyce, and that two of the colors were quite exasperatingly lovely — Orange who kept fidgetingallthetime,andEmeraldwho,whenhereyesgotusedtothepitch-black pit where we all heavily sat, suddenly smiled at her mother or her protector. As soon as the thing was over, and manual applause — a sound my nerves cannot stand — began to crash all around me, I started to pull and push Lo toward the exit, in my so natural amorous impatience to get her back to our neon-blue cottage in the stunned, starry night: I always say nature is stunned by the sights she sees. Dolly-Lo, however, lagged behind, in a rosy daze, her pleased eyes narrowed, her sense of vision swamping the rest of her senses to such an extent that her limp hands hardly came together at all in the mechanical action of clapping they still went through. I had seen that kind of thing in children before but, by God, this was a special child, myopically beaming at the already remote stage where I glimpsed something of the joint authors — a man’s tuxedo and the bare shoulders of a hawk-like, black-haired, strikingly tall woman. “You’ve again hurt my wrist, you brute,” said Lolita in a small voice as she slipped into her car seat. “I am dreadfully sorry, my darling, my own ultraviolet darling,” I said, unsuccessfully trying to catch her elbow, and I added, to change the conversation — to change the direction of fate, oh God, oh God: “Vivian is quite a woman. I am sure we saw her yesterday in that restaurant, in Soda pop.” “Sometimes,” said Lo, “you are quite revoltingly dumb. First, Vivian is the male author, the gal author is Clare; and second, she is forty, married and has Negro blood.” “I thought,” I said kidding her, “Quilty was an ancient flameofyours,inthedayswhen you loved me, in sweet old Ramsdale.” “What?” countered Lo, her features working. “Thatfatdentist?Youmustbeconfusing me with some other fast little article.” And I thought to myself how those fast little articles forget everything, everything, while we, old lovers, treasure every inch of their nymphancy. 19 With Lo’s knowledge and assent, the two post officesgiventotheBeardsleypostmaster as forwarding addresses were P.O. Wace and P.O. Elphinstone. Next morning we visited the former and had to wait in a short but slow queue. Serene Lo studied Vladimir Nabokov — Lolita 147 the rogues’ gallery. Handsome Bryan Bryanski, alias Anthony Bryan, alias Tony Brown, eyes hazel, complexion fair, was wanted for kidnapping. A sad-eyed old gentleman’s faux-pas was mail fraud, and, as if that were not enough, he was cursed with deformed arches. Sullen Sullivan came with a caution: Is believed armed, and should be considered extremely dangerous. If you want to make a movie out of my book, have one of these faces gently melt into my own, while I look. And moreover there was a smudgy snapshot of a Missing Girl, age fourteen, wearing brown shoes when last seen, rhymes. Please notify SheriffBuller. I forget my letters; as to Dolly’s, there was her report and a very special-looking envelope. ThisIdeliberatelyopenedandperuseditscontents.IconcludedIwasdoing the foreseen since she did not seem to mind and drifted toward the newsstand near the exit. “Dolly-Lo: Well, the play was a grand success. All three hounds lay quiet having been slightly drugged by Cutler, I suspect, and Linda knew all your lines. She was fine,shehadalertnessandcontrol,butlackedsomehowtheresponsiveness, the relaxed vitality, the charm of my — and the author’s — Diana; but there was no author to applaud us as last time, and the terrificelectricstormoutsideinterferedwithourownmodest offstagethunder.Ohdear,lifedoesfly.Nowthateverythingisover,school,play, the Roy mess, mother’s confinement(ourbaby,alas,didnotlive!),itallseemssuch a long time ago, though practically I still bear traces of the paint. “We are going to New York after to-morrow, and I guess I can’t manage to wriggle out of accompanying my parents to Europe. I have even worse news for you. Dolly-Lo! I may not be back at Beardsley if and when you return. With one thing and another, one being you know who, and the other not being who you think you know, Dad wants me to go to school in Paris for one year while he and Fullbright are around. “As expected, poor Poet stumbled in Scene III when arriving at the bit of French nonsense. Remember? Ne manque pas de dire à ton amant, Chimène, comme le lac est beau car il faut qu’il t’y mène. Lucky beau! Qu’il t’y — What a tongue-twister! Well, be good, Lollikins. Best love from your Poet, and best regards to the Governor. Your Mona. P.S. Because of one thing and another, my correspondence happens to be rigidly controlled. So better wait till I write you from Europe.” (She never did as far as I know. ThelettercontainedanelementofmysteriousnastinessthatIamtootiredtodaytoanalyze. I found it later preserved in one of the Tour Books, and give it here à titre documentaire. I read it twice.) I looked up from the letter and was about to — TherewasnoLotobehold.WhileI was engrossed in Mona’s witchery, Lo had shrugged her shoulders and vanished. “Did you happen to see —” I asked of a hunchback sweeping the floorneartheentrance. He had, the old lecherer. He guessed she had seen a friend and had hurried out. I hurried out too. I stopped — she had not. I hurried on. I stopped again. It had happened at last. She had gone for ever. In later years I have often wondered why she did not go forever that day. Was it the retentive quality of her new summer clothes in my locked car? Was it some unripe 148 Lolita — Vladimir Nabokov particle in some general plan? Was it simply because, all things considered, I might as well be used to convey her to Elphinstone — the secret terminus, anyway? I only know I was quite certain she had left me for ever. Thenoncommittalmauvemountainshalfencircling the town seemed to me to swarm with panting, scrambling, laughing, panting Lolitas who dissolved in their haze. A big W made of white stones on a steep talus in the far vista of a cross street seemed the very initial of woe. ThenewandbeautifulpostofficeIhadjustemergedfromstoodbetweenadormant movie house and a conspiracy of poplars. Thetimewas9a.m.mountaintime.Thestreetwascharmingitintobeauty,wasoneofthosefragileyoungsummermornings with flashesofglasshereandthereandageneralairoffalteringandalmostfainting at the prospect of an intolerably torrid noon. Crossing over, I loafed and leafed, as it were, through one long block: Drugs, Real Estate, Fashions, Auto Parts, Cafe, Sporting Goods, Real Estate, Furniture, Appliances, Western Union, Cleaners, Grocery. Officer,officer,mydaughterhas run away.Incollusionwithadetective;inlovewitha black-mailer. Took advantage of my utter helplessness. I peered into all the stores. I deliberated inly if I should talk to any of the sparse foot-passengers. I did not. I sat for a while in the parked car. I inspected the public garden on the east side. I went back to Fashions and Auto Parts. I told myself with a burst of furious sarcasm — un ricanement — that I was crazy to suspect her, that she would turn up any minute. She did. I wheeled around and shook offthehandshehadplacedonmysleevewithatimidand imbecile smile. “Get into the car,” I said. She obeyed, and I went on pacing up and down, struggling with nameless thoughts, trying to plan some way of tackling her duplicity. Presently she left the car and was at my side again. My sense of hearing gradually got tuned in to station Lo again, and I became aware she was telling me that she had met a former girl friend. “Yes? Whom?” “A Beardsley girl.” “Good. I now every name in your group. Alice Adams?” “Thegirlwasnotinmygroup.” “Good. I have a complete student list with me. Her name please.” “She was not in my school She is just a town girl in Beardsley.” “Good. I have the Beardsley directory with me too. We’ll look up all the Browns.” “I only know her firstname.” “Mary or Jane?” “No — Dolly, like me.” “So that’s the dead end” (the mirror you break your nose against). “Good. Let us try another angle. You have been absent twenty-eight minutes. What did the two Dollys do?” “We went to a drugstore.” Vladimir Nabokov — Lolita 149 “And you had there —?” “Oh, just a couple of Cokes.” “Careful, Dolly. We can check that, you know.” “At least, she had. I had a glass of water.” “Good. Was it that place there?” “Sure.” “Good, come on, we’ll grill the soda jerk.” “Wait a sec. Come to think it might have been further down — just around the corner.” “Come on all the same. Go in please. Well, let’s see.” (Opening a chained telephone book.) “DignifiedFuneralService.NO,notyet.Hereweare:Druggists-Retail.Hill Drug Store. Larkin’s Pharmacy. And two more. That’sallWaceseemstohavein the way of soda fountains — at least in the business section. Well, we will check them all.” “Go to hell,” she said. “Lo, rudeness will get you nowhere.” “Okay,” she said. “But you’re not going to trap me. Okay, so we did not have a pop. We just talked and looked at dresses in show windows.” “Which? Thatwindowthereforexample?” “Yes, that one there, for example.” “Oh Lo! Let’s look closer at it.” It was indeed a pretty sight. A dapper young fellow was vacuum-cleaning a carpet upon which stood two figuresthatlookedasifsomeblasthadjustworkedhavocwith them. One figurewasstarknaked,wiglessandarmless.Itscomparativelysmallstature and smirking pose suggested that when clothed it had represented, and would represent when clothed again, a girl-child of Lolita’s size. But in its present state it was sexless. Next to it, stood a much taller veiled bride, quite perfect and intacta except for the lack of one arm. On the floor,atthefeetofthesedamsels,wherethemancrawled about laboriously with his cleaner, there lay a cluster of three slender arms, and a blond wig. Two of the arms happened to be twisted and seemed to suggest a clasping gesture of horror and supplication. “Look, Lo,” I said quietly. “Look well. Is not that a rather good symbol of something or other? However” — I went on as we got back into the car — “I have taken certain precautions. Here (delicately opening the glove compartment), on this pad I have our boy friend’s car number.” As the ass I was I had not memorized it. What remained of it in my mind were the initial letter and the closing figureasifthewholeamphitheaterofsixsignsreceded concavely behind a tinted glass too opaque to allow the central series to be deciphered, but just translucent enough to make out its extreme edges — a capital P and a 6. I have to go into those details (which in themselves can interest only a professional psychologue) because otherwise the reader (ah, if I could visualize him as a blond-bearded scholar with rosy lips sucking la pomme de sa canne as he quaffsmymanu150 Lolita — Vladimir Nabokov script!) might not understand the quality of the shock I experienced upon noticing that the P had acquired the bustle of a B and that the 6 had been deleted altogether. Therest,witherasuresrevealingthehurriedshuttlesmearofapencil’srubberend,and with parts of numbers obliterated or reconstructed in a child’s hand, presented a tangle of barbed wire to any logical interpretation. All I knew was the state — one adjacent to the state Beardsley was in. I said nothing. I put the pad back, closed the compartment, and drove out of Wace. Lo had grabbed some comics from the back seat and, mobile-white-bloused, one brown elbow out of the window, was deep in the current adventure of some clout or clown. ThreeorfourmilesoutofWace,Iturnedintotheshadowofapicnicgroundwhere the morning had dumped its litter of light on an empty table; Lo looked up with a semi-smile of surprise and without a word I delivered a tremendous backhand cut that caught her smack on her hot hard little cheekbone. And then the remorse, the poignant sweetness of sobbing atonement, groveling love, the hopelessness of sensual reconciliation. In the velvet night, at Mirana Motel (Mirana!) I kissed the yellowish soles of her long-toed feet, I immolated myself… But it was all of no avail. both doomed were we. And soon I was to enter a new cycle of persecution. In a street of Wace, on its outskirts… Oh, I am quite sure it was not a delusion. In a street of Wace, I had glimpsed the Aztec Red Convertible, or its identical twin. Instead of Trapp, it contained four or fiveloudyoungpeopleofseveralsexes—butI said nothing. After Wace a totally new situation arose. For a day or two, I enjoyed the mental emphasis with which I told myself that we were not, and never had been followed; and then I became sickeningly conscious that Trapp had changed his tactics and was still with us, in this or that rented car. A veritable Proteus of the highway, with bewildering ease he switched from one vehicle to another. Thistechniqueimpliedtheexistenceofgaragesspecializingin“stage-automobile” operations, but I never could discover the remises he used. He seemed to patronize at firsttheChevroletgenus,beginningwithaCampusCreamconvertible, then going on to a small Horizon Blue sedan, and thenceforth fading into Surf Gray and Driftwood Gray. Thenheturnedtoothermakesandpassedthrougha pale dull rainbow of paint shades, and one day I found myself attempting to cope with the subtle distinction between our own Dream Blue Melmoth and the Crest Blue Oldsmobile he had rented; grays, however, remained his favorite cryptochromism, and, in agonizing nightmares, I tried in vain to sort out properly such ghosts as Chrysler’s Shell Gray, Chevrolet’s ThistleGray,Dodge’sFrenchGray… Thenecessityofbeingconstantlyonthelookoutforhislittlemustacheandopenshirt — or for his baldish pate and broad shoulders — led me to a profound study of all cars on the road — behind, before, alongside, coming, going, every vehicle under the dancing sun: the quiet vacationist’s automobile with the box of Tender-Touch tissues in the back window; the recklessly speeding jalopy full of pale children with a shaggy dog’s head protruding, and a crumpled mudguard; the bachelor’s tudor sedan Vladimir Nabokov — Lolita 151 crowded with suits on hangers; the huge fat house trailer weaving in front, immune to the Indian fileoffuryboilingbehindit;thecarwiththeyoungfemalepassengerpolitely perched in the middle of the front seat to be closer to the young male driver; the car carrying on its roof a red boat bottom up… Thegraycarslowingupbeforeus,the gray car catching up with us. We were in mountain country, somewhere between Snow and Champion, and rolling down an almost imperceptible grade, when I had my next distinct view of Detective Paramour Trapp. Thegraymistbehindushaddeepenedandconcentratedintothecompactness of a Dominion Blue sedan. All of a sudden, as if the car I drove responded to my poor heart’s pangs, we were slithering from side to side, with something making a helpless plap-plap-plap under us. “You got a flat,mister,”saidcheerfulLo. I pulled up — near a precipice. She folded her arms and put her foot on the dashboard. I got out and examined the right rear wheel. Thebaseofitstirewassheepishly and hideously square. Trapp had stopped some fiftyyardsbehindus.Hisdistantface formed a grease spot of mirth. Thiswasmychance.Istartedtowalktowardshim — with the brilliant idea of asking him for a jack through I had one. He backed a little. I stubbed my toe against a stone — and there was a sense of general laughter. ThenatremendoustruckloomedfrombehindTrappandthunderedbyme—andimmediately after, I heard it utter a convulsive honk. Instinctively I looked back — and saw my own car gently creeping away. I could make out Lo ludicrously at the wheel, and the engine was certainly running — though I remembered I had cut it but had not applied the emergency brake; and during the brief space of throb-time that it took me to reach the croaking machine which came to a standstill at last, it dawned upon me that during the last two years little Lo had had ample time to pick up the rudiments of driving. As I wrenched the door open, I was goddam sure she had started the car to prevent me from walking up to Trapp. Her trick proved useless, however, for even while I was pursuing her he had made an energetic U-turn and was gone. I rested for a while. Lo asked wasn’t I going to thank her — the car had started to move by itself and — Getting no answer, she immersed herself in a study of the map. I got out again and commenced the “ordeal of the orb,” as Charlotte used to say. Perhaps, I was losing my mind. We continued our grotesque journey. After a forlorn and useless dip, we went up and up. On a steep grade I found myself behind the gigantic truck that had overtaken us. It was now groaning up a winding road and was impossible to pass. Out of its front part a small oblong of smooth silver — the inner wrapping of chewing gum — escaped and flewbackintoourwindshield.ItoccurredtomethatifIwerereallylosingmymind, I might end by murdering somebody. In fact — said high-and-dry Humbert to flounderingHumbert—itmightbequiteclevertopreparethings—totransferthe weapon from box to pocket — so as to be ready to take advantage of the spell of insanity when it does come. 152 Lolita — Vladimir Nabokov 20 By permitting Lolita to study acting I had, fond fool, sufferedhertocultivatedeceit.It now appeared that it had not been merely a matter of learning the answers to such questions as what is the basic conflictin“HeddaGabler,”orwherearetheclimaxesin “Love Under the Lindens,” or analyze the prevailing mood of “Cherry Orchard”; it was really a matter of learning to betray me. How I deplored now the exercises in sensual simulation that I had so often seen her go through in our Beardsley parlor when I would observe her from some strategic point while she, like a hypnotic subject of a performer in a mystic rite, produced sophisticated version of infantile make-believe by going through the mimetic actions of hearing a moan in the dark, seeing for the firsttimeabrandnewyoungstepmother,tastingsomethingshehated,suchas buttermilk, smelling crushed grass in a lush orchard, or touching mirages of objects with her sly, slender, girl-child hands. Among my papers I still have a mimeographed sheet suggesting: Tactile drill. Imagine Yourself picking up and holding: a pingpong ball, an apple, a sticky date, a new flannel-fluffedtennisball,ahotpotato,an icecube,akitten,a puppy, a horseshoe, a feather, a flashlight. Knead with your fingersthefollowingimaginarythings:apieceofbrad,indiarubber, a friend’s aching temple, a sample of velvet, a rose petal. You are a blind girl. Palpate the face of: a Greek youth, Cyrano, Santa Claus, a baby, a laughing faun, a sleeping stranger, your father. But she had been so pretty in the weaving of those delicate spells, in the dreamy performance of her enchantments and duties! On certain adventurous evenings, in Beardsley, I also had her dance for me with the promise of some treat or gift, and although these routine leg-parted leaps of hers were more like those of a football cheerleader than like the languorous and jerky motions of a Parisian petit rat, the rhythms of her not quite nubile limbs had given me pleasure. But all that was nothing, absolutely nothing, to the indescribable itch of rapture that her tennis game produced in me — the teasing delirious feeling of teetering on the very brink of unearthly order and splendor. Despite her advanced age, she was more of a nymphet than ever, with her apricot-colored limbs, in her sub-teen tennis togs! Winged gentlemen! No hereafter is acceptable if it does not produce her as she was then, in that Colorado resort between Snow and Elphinstone, with everything right: the white wide little-boy shorts, the slender waist, the apricot midriff,thewhitebreast-kerchiefwhoseribbonswentupandencircled her neck to end behind in a dangling knot leaving bare her gaspingly young and adorable apricot shoulder blades with that pubescence and those lovely gentle bones, and the smooth, downward-tapering back. Her cap had a white peak. Her racket had cost me a small fortune. Idiot, triple idiot! I could have filmedher!Iwouldhavehadher now with me, before my eyes, in the projection room of my pain and despair! Vladimir Nabokov — Lolita 153 She would wait and relax for a bar or two of white-lined time before going into the act of serving, and often bounced the ball once or twice, or pawed the ground a little, always at ease, always rather vague about the score, always cheerful as she so seldom was in the dark life she led at home. Her tennis was the highest point to which I can imagine a young creature bringing the art of make-believe, although I daresay, for her it was the very geometry of basic reality. Theexquisiteclarityofallhermovementshaditsauditorycounterpartinthepureringing sound of her every stroke. Theballwhenitenteredherauraofcontrolbecamesomehow whiter, its resilience somehow richer, and the instrument of precision she used upon it seemed inordinately prehensile and deliberate at the moment of clinging contact. Her form was, indeed, an absolutely perfect imitation of absolutely top-notch tennis — without any utilitarian results. As Edusa’s sister, Electra Gold, a marvelous young coach, said to me once while I sat on a pulsating hard bench watching Dolores Haze toying with Linda Hall (and being beaten by her): “Dolly has a magnet in the center of her racket guts, but why the heck is she so polite?” Ah, Electra, what did it matter, with such grace! I remember at the very firstgameIwatchedbeingdrenchedwith an almost painful convulsion of beauty assimilation. My Lolita had a way of raising her bent left knee at the ample and springy start of the service cycle when there would develop and hang in the sun for a second a vital web of balance between toed foot, pristine armpit, burnished arm and far back-flungracket,asshesmiledupwithgleaming teeth at the small globe suspended so high in the zenith of the powerful and graceful cosmos she had created for the express purpose of falling upon it with a clean resounding crack of her golden whip. It had, that serve of hers, beauty, directness, youth, a classical purity of trajectory, and was, despite its spanking pace, fairly easy to return, having as it did no twist or sting to its long elegant hop. ThatIcouldhavehadallherstrokes,allherenchantments,immortalizedinsegments of celluloid, makes me moan today with frustration. Theywouldhavebeensomuch more than the snapshots I burned! Her overhead volley was related to her service as the envoy is to the ballade; for she had been trained, my pet, to patter up at once to the net on her nimble, vivid, white-shod feet. Therewasnothingtochoosebetween her forehand and backhand drives: they were mirror images of one another — my very loins still tingle with those pistol reports repeated by crisp echoes and Electra’s cries. One of the pearls of Dolly’s game was a short half-volley that Ned Litam had taught her in California. She preferred acting to swimming, and swimming to tennis; yet I insist that had not something within her been broken by me — not that I realized it then! — she would have had on the top of her perfect form the will to win, and would have become a real girl champion. Dolores, with two rackets under her arm, in Wimbledon. Dolores endorsing a Dromedary. Dolores turning professional. Dolores acting a girl champion in a movie. Dolores and her gray, humble, hushed husband-coach, old Humbert. 154 Lolita — Vladimir Nabokov Therewasnothingwrongordeceitfulinthespiritofhergame—unlessoneconsidered her cheerful indifferencetowarditsoutcomeasthefeintofanymphet.Shewhowas so cruel and crafty in everyday life, revealed an innocence, a frankness, a kindness of ball-placing, that permitted a second-rate but determined player, no matter how uncouth and incompetent, to poke and cut his way to victory. Despite her small stature, she covered the one thousand and fifty-threesquarefeetofherhalfofthecourtwithwonderful ease, once she had entered into the rhythm of a rally and as long as she could direct that rhythm; but any abrupt attack, or sudden change of tactics on her adversary’s part, left her helpless. At match point, her second serve, which — rather typically — was even stronger and more stylish than her first(forshehadnoneoftheinhibitionsthatcautious winners have), would strike vibrantly the hard-cord of the net — and ricochet out of court. Thepolishedgemofherdropshotwassnappedupandputawaybyanopponent who seemed four-legged and wielded a crooked paddle. Her dramatic drives and lovely volleys would candidly fall at his feet. Over and over again she would land an easy one into the net — and merrily mimic dismay by drooping in a ballet attitude, with her forelocks hanging. So sterile were her grace and whipper that she could not even win from panting me and my old-fashioned lifting drive. I suppose I am especially susceptible to the magic of games. In my chess sessions with Gaston I saw the board as a square pool of limpid water with rare shells and stratagems rosily visible upon the smooth tessellated bottom, which to my confused adversary was all ooze and squid-cloud. Similarly, the initial tennis coaching I had inflictedonLolita—priortotherevelationsthatcametoherthroughthegreatCalifornian’s lessons — remained in my mind as oppressive and distressful memories — not only because she had been so hopelessly and irritatingly irritated by every suggestion of mine — but because the precious symmetry of the court instead of reflectingthe harmonies latent in her was utterly jumbled by the clumsiness and lassitude of the resentful child I mistaught. Now things were different,andonthatparticularday,in the pure air of Champion, Colorado, on that admirable court at the foot of seep stone stairs leading up to Champion Hotel where we had spent the night, I felt I could rest from the nightmare of unknown betrayals within the innocence of her style, of her soul, of her essential grace. She was hitting hard and flat,withherusualeffortlesssweep,feedingmedeepskimming balls — all so rhythmically coordinated and overt as to reduce my footwork to, practically, a swinging stroll — crack players will understand what I mean. My rather heavily cut serve that I had been taught by my father who had learned it from Decugis or Borman, old friends of his and great champions, would have seriously troubled my Lo, had I really tried to trouble her. But who would upset such a lucid dear? Did I ever mention that her bare arm bore the 8 of vaccination? ThatIlovedherhopelessly? Thatshewasonlyfourteen? An inquisitive butterflypassed,dipping,betweenus. Two people in tennis shorts, a red-haired fellow only about eight years my junior, and an indolent dark girl with a moody mouth and hard eyes, about two years LolVladimir Nabokov — Lolita 155 ita’s senior, appeared from nowhere. As is common with dutiful tyros, their rackets were sheathed and framed, and they carried them not as if they were the natural and comfortable extensions of certain specialized muscles, but hammers or blunderbusses or wimbles, or my own dreadful cumbersome sins. Rather unceremoniously seating themselves near my precious coat, on a bench adjacent to the court, they fell to admiring very vocally a rally of some fiftyexchangesthatLoinnocentlyhelpedmetofoster and uphold — until there occurred a syncope in the series causing her to gasp as her overhead smash went out of court, whereupon she melted into winsome merriment, my golden pet. I felt thirsty by then, and walked to the drinking fountain; there Red approached me and in all humility suggested a mixed double. “I am Bill Mead,” he said. “And that’s Fay Page, actress. MaffyOnSay”—headded(pointingwithhisridiculouslyhoodedracket at polished Fay who was already talking to Dolly). I was about to reply “Sorry, but —” (for I hate to have my fillyinvolvedinthechopsandjabsofcheapbunglers),when a remarkably melodious cry diverted my attention: a bellboy was tripping down the steps from the hotel to our court and making me signs. I was wanted, if you please, on an urgent long distance call — so urgent in fact that the line was being held for me. Certainly. I got into my coat (inside pocket heavy with pistol) and told Lo I would be back in a minute. She was picking up a ball — in the continental foot-racket way which was one of the few nice things I had taught her, — and smiled — she smiled at me! An awful calm kept my heart afloatasIfollowedtheboyuptothehotel.This,touse an American term, in which discovery, retribution, torture, death, eternity appear in the shape of a singularly repulsive nutshell, was it. I had left her in mediocre hands, but it hardly mattered now. I would fight,ofcourse.Oh,Iwouldfight.Betterdestroyeverything than surrender her. Yes, quite a climb. At the desk, dignified,Roman-nosedman,with,Isuggest,averyobscurepastthatmight reward investigation, handed me a message in his own hand. Thelinehadnotbeen held after all. Thenotesaid: “Mr. Humbert. TheheadofBirdsley(sic!)Schoolcalled.Summerresidence—Birdsley 2-82-82. Please call back immediately. Highly important.” I folded myself into a booth, took a little pill, and four about twenty minutes tussled with space-spooks. A quartet of propositions gradually became audible: soprano, there was no such number in Beardsley; alto, Miss Pratt was on her way to England; tenor, Beardsley School had not telephoned; bass, they could not have done so, since nobody knew I was, that particular day, in Champion, Colo. Upon my stinging him, the Roman took the trouble to findoutiftherehadbeenalongdistancecall.Therehad been none. A fake call from some local dial was not excluded. I thanked him. He said: You bet. After a visit to the purling men’s room and a stiffdrinkatthebar,I started on my return march. From the very firstterraceIsaw,farbelow,onthetenniscourt which seemed the size of a school child’s ill-wiped slate, golden Lolita playing in a double. She moved like a fair angel among three horrible Boschian cripples. One of these, her partner, while changing sides, jocosely slapped her on her behind with his 156 Lolita — Vladimir Nabokov racket. He had a remarkably round head and wore incongruous brown trousers. Therewas a momentary flurry—hesawme,andthrowingawayhisracket—mine—scuttledup the slope. He waved his wrists and elbows in a would-be comical imitation of rudimentary wings, as he climbed, blow-legged, to the street, where his gray car awaited him. Next moment he and the grayness were gone. When I came down, the remaining trio were collecting and sorting out the balls. “Mr. Mead, who was that person?” Bill and Fay, both looking very solemn, shook their heads. Thatabsurdintruderhadbuttedintomakeupadouble,hadn’the,Dolly? Dolly. Thehandleofmyracketwasstilldisgustinglywarm.Beforereturningtothe hotel, I ushered her into a little alley half-smothered in fragrant shrubs, with flowers like smoke, and was about to burst into ripe sobs and plead with her imperturbed dream in the most abject manner for clarification,nomatterhowmeretricious,ofthe slow awfulness enveloping me, when we found ourselves behind the convulsed Mead twosome — assorted people, you know, meeting among idyllic settings in old comedies. Bill and Fay were both weak with laughter — we had come at the end of their private joke. It did not really matter. Speaking as if it really did not really matter, and assuming, apparently, that life was automatically rolling on with all its routine pleasures, Lolita said she would like to change into her bathing things, and spend the rest of the afternoon at the swimming pool. It was a gorgeous day. Lolita! 21 “Lo! Lola! Lolita!” I hear myself crying from a doorway into the sun, with the acoustics of time, domed time, endowing my call and its tell-tale hoarseness with such a wealth of anxiety, passion and pain that really it would have been instrumental in wrenching open the zipper of her nylon shroud had she been dead. Lolita! In the middle of a trim turfed terrace I found her at last — she had run out before I was ready. Oh Lolita! Thereshewasplayingwithadamneddog,notme.Theanimal,a terrierofsorts,was losing and snapping up again and adjusting between his jaws a wet little red ball; he took rapid chords with his front paws on the resilient turf, and then would bounce away. I had only wanted to see where she was, I could not swim with my heart in that state, but who cared — and there she was, and there was I, in my robe — and so I stopped calling; but suddenly something in the pattern of her motions, as she dashed this way and that in her Aztec Red bathing briefs and bra, struck me… there was an ecstasy, a madness about her frolics that was too much of a glad thing. Even the dog seemed puzzled by the extravagance of her reactions. I put a gentle hand to my chest as I surveyed the situation. Theturquoiseblueswimmingpoolsomedistancebehind the lawn was no longer behind that lawn, but within my thorax, and my organs swam in it like excrements in the blue sea water in Nice. One of the bathers had left Vladimir Nabokov — Lolita 157 the pool and, half-concealed by the peacocked shade of trees, stood quite still, holding the ends of the towel around his neck and following Lolita with his amber eyes. Therehe stood, in the camouflageofsunandshade,disfiguredbythemandmaskedbyhisown nakedness, his damp black hair or what was left of it, glued to his round head, his little mustache a humid smear, the wool on his chest spread like a symmetrical trophy, his naval pulsating, his hirsute thighs dripping with bright droplets, his tight wet black bathing trunks bloated and bursting with vigor where his great fat bullybag was pulled up and back like a padded shield over his reversed beasthood. And as I looked at his oval nut-brown face, it dawned upon me that what I had recognized him by was the reflectionofmydaughter’scountenance—thesamebeatitudeandgrimacebut made hideous by his maleness. And I also knew that the child, my child, knew he was looking, enjoyed the lechery of his look and was putting on a show of gambol and glee, the vile and beloved slut. As she made for the ball and missed it, she fell on her back, with her obscene young legs madly pedaling in the air; I could sense the musk of her excitement from where I stood, and then I saw (petrifiedwithakindofsacreddisgust) the man close his eyes and bare his small, horribly small and even, teeth as he leaned against a tree in which a multitude of dappled Priaps shivered. Immediately afterwards a marvelous transformation took place. He was no longer the satyr but a very good-natured and foolish Swiss cousin, the Gustave Trapp I have mentioned more than once, who used to counteract his “sprees” (he drank beer with milk, the good swine) by feats of weight-lifting — tottering and grunting on a lake beach with his otherwise very complete bathing suit jauntily stripped from one shoulder. This Trapp noticed me from afar and working the towel on his name walked back with false insouciance to the pool. And as if the sun had gone out of the game, Lo slackened and slowly got up ignoring the ball that the terrier placed before her. Who can say what heartbreaks are caused in a dog by our discontinuing a romp? I started to say something, and then sat down on the grass with a quite monstrous pain in my chest and vomited a torrent of browns and greens that I had never remembered eating. I saw Lolita’s eyes, and they seemed to be more calculating than frightened. I heard her saying to a kind lady that her father was having a fit.Thenfora longtimeI layin a lounge chair swallowing pony upon pony of gin. And next morning I felt strong enough to drive on (which in later years no doctor believed). 22 Thetwo-roomcabinwehadorderedatSilverSpurCourt,Elphinstone,turnedoutto belong to the glossily browned pine-log kind that Lolita used to be so fond of in the days of our carefree firstjourney;oh,howdifferentthingswerenow!I amnotreferring to Trapp or Trapps. After all — well, really… After all, gentlemen, it was becoming abundantly clear that all those identical detectives in prismatically changing cars were figmentsofmypersecutionmania,recurrentimagesbasedoncoincidenceand 158 Lolita — Vladimir Nabokov chance resemblance. Soyons logiques, crowed the cocky Gallic part of my brain — and proceeded to rout the notion of a Lolita-maddened salesman or comedy gangster, with stooges, persecuting me, and hoaxing me, and otherwise taking riotous advantage of my strange relations with the law. I remember humming my panic away. I remember evolving even an explanation of the “Birdsley” telephone call… But if I could dismiss Trapp, as I had dismissed my convulsions on the lawn at Champion, I could do nothing with the anguish of knowing Lolita to be so tantalizingly, so miserably unattainable and beloved on the very even of a new era, when my alembics told me she should stop being a nymphet, stop torturing me. An additional, abominable, and perfectly gratuitous worry was lovingly prepared for me in Elphinstone. Lo had been dull and silent during the last lap — two hundred mountainous miles uncontaminated by smoke-gray sleuths or zigzagging zanies. She hardly glanced at the famous, oddly shaped, splendidly flushedrockwhichjuttedabove the mountains and had been the take-offfornirvanaonthepartofatemperamental show girl. Thetownwasnewlybuilt,orrebuilt,ontheflatfloorof aseven-thousand-foot-high valley; it would soon bore Lo, I hoped, and we would spin on to California, to the Mexican border, to mythical bays, saguaro desserts, fatamorganas. José Lizzarrabengoa, as you remember, planned to take his Carmen to the Etats Unis. I conjured up a Central American tennis competition in which Dolores Haze and various Californian schoolgirl champions would dazzlingly participate. Good-will tours on that smiling level eliminate the distinction between passport and sport. Why did I hope we would be happy abroad? A change of environment is the traditional fallacy upon which doomed loves, and lungs, rely. Mrs. Hays, the brisk, briskly rouged, blue-eyed widow who ran the motor court, asked me if I were Swiss perchance, because her sister had married a Swiss ski instructor. I was, whereas my daughter happened to be half Irish. I registered, Hays gave me the key and a tinkling smile, and, still twinkling, showed me where to park the car; Lo crawled out and shivered a little: the luminous evening air was decidedly crisp. Upon entering the cabin, she sat down on a chair at a card table, buried her face in the crook of her arm and said she felt awful. Shamming, I thought, shamming, no doubt, to evade my caresses; I was passionately parched; but she began to whimper in an unusually dreary way when I attempted to fondle her. Lolita ill. Lolita dying. Her skin was scalding hot! I took her temperature, orally, then looked up a scribbled formula I fortunately had in a jotter and after laboriously reducing the, meaningless to me, degrees Fahrenheit to the intimate centigrade of my childhood, found she had 40.4, which at least made sense. Hysterical little nymphs might, I knew, run up all kinds of temperature — even exceeding a fatal count. And I would have given her a sip of hot spiced wine, and two aspirins, and kissed the fever away, if, upon an examination of her lovely uvula, one of the gems of her body, I had not seen that it was a burning red. I undressed her. Her breath was bittersweet. Her brown rose tasted of blood. She was shaking from head to toe. She complained of a painful stiffnessintheuppervertebrae — and I thought of poliomyelitis as any American parent would. Giving up Vladimir Nabokov — Lolita 159 all hope of intercourse, I wrapped her in a laprobe and carried her into the car. Kind Mrs. Hays in the meantime had alerted the local doctor. “You are lucky it happened here,” she said; for not only was Blue the best man in the district, but the Elphinstone hospital was as modern as modern could be, despite its limited capacity. With a heterosexual Erlkönig in pursuit, thither I drove, half-blinded by a royal sunset on the lowland side and guided by a little old woman, a portable witch, perhaps his daughter, whom Mrs. Hays had lent me, and whom I was never to see again. Dr. Blue, whose learning, no doubt, was infinitelyinferiortohisreputation,assuredmeitwasavirusinfection, and when I alluded to her comparatively recent flu,curtlysaidthiswasanother bug, he had forty such cases on his hands; all of which sounded like the “ague” of the ancients. I wondered if I should mention, with a casual chuckle, that my fifteen-year-old daughter had had a minor accident while climbing an awkward fence with her boy friend, but knowing I was drunk, I decided to withhold the information till later if necessary. To an unsmiling blond bitch of a secretary I gave my daughter’s age as “practically sixteen.” While I was not looking, my child was taken away from me! In vain I insisted I be allowed to spend the night on a “welcome” mat in a corner of their damned hospital. I ran up constructivistic flightsofstairs,Itriedtotracemydarling so as to tell her she had better not babble, especially if she felt as lightheaded as we all did. At one point, I was rather dreadfully rude to a very young and very cheeky nurse with overdeveloped gluteal parts and blazing black eyes — of Basque descent, as I learned. Her father was an imported shepherd, a trainer of sheep dogs. Finally, I returned to the car and remained in it for I do not know how many hours, hunched up in the dark, stunned by my new solitude, looking out open-mouthed now at the dimly illumined, very square and low hospital building squatting in the middle of its lawny block, now up at the wash of stars and the jagged silvery ramparts of the haute montagne where at the moment Mary’s father, lonely Joseph Lore was dreaming of Oloron, Lagore, Rolas — que sais-je! — or seducing a ewe. Such-like fragrant vagabond thoughts have been always a solace to me in times of unusual stress, and only when, despite liberal libations, I felt fairly numbed by the endless night, did I think of driving back to the motel. Theoldwomanhaddisappeared,andIwasnotquitesureofmyway.Widegravel roads criss-crossed drowsy rectangular shadows. I made out what looked like the silhouette of gallows on what was probably a school playground; and in another wastelike block there rose in domed silence the pale temple of some local sect. I found the highway at last, and then the motel, where millions of so-called “millers,” a kind of insect, were swarming around the neon contours of “No Vacancy”; and, when, at 3 a.m., after one of those untimely hot showers which like some mordant only help to fixaman’sdespairandweariness,Ilayonherbedthatsmelledofchestnutsandroses,and peppermint, and the very delicate, very special French perfume I latterly allowed her to use, I found myself unable to assimilate the simple fact that for the firsttimeintwo years I was separated from my Lolita. All at once it occurred to me that her illness was somehow the development of a theme — that it had the same taste and tone as the series of linked impressions which had puzzled and tormented me during our 160 Lolita — Vladimir Nabokov journey; I imagined that secret agent, or secret lover, or prankster, or hallucination, or whatever he was, prowling around the hospital — and Aurora had hardly “warmed her hands,” as the pickers of lavender way in the country of my birth, when I found myself trying to get into that dungeon again, knocking upon its green doors, breakfastless, stool-less, in despair. ThiswasTuesday,andWednesdayorThursday,splendidlyreactinglikethedarlingshe was to some “serum” (sparrow’s sperm or dugong’s dung), she was much better, and the doctor said that in a couple of days she would be “skipping” again. Of the eight times I visited her, the last one alone remains sharply engraved on my mind. It had been a great feat to come for I felt all hollowed out by the infection that by then was at work on me too. None will know the strain it was to carry that bouquet, that load of love, those books that I had traveled sixty miles to buy: Browning’s Dramatic Works, TheHistoryofDancing,ClownsandColumbines,TheRussianBallet, Flowers of the Rockies, TheTheatreGuildAnthology, Tennis by Helen Wills, who had won the National Junior Girl Singles at the age of fifteen.AsIwasstaggeringuptothe door of my daughter’s thirteen-dollar-a day private room, Mary Lore, the beastly young part-time nurse who had taken an unconcealed dislike to me, emerged with a finishedbreakfasttray,placeditwithaquickcrashonachairinthecorridor,and,fundament jigging, shot back into the room — probably to warn her poor little Dolores that the tyrannical old father was creeping up on crepe soles, with books and bouquet: the latter I had composed of wild flowersandbeautifulleavesgatheredwithmyowngloved hands on a mountain pass at sunrise (I hardly slept at all that fateful week). Feeding my Carmencita well? Idly I glanced at the tray. On a yolk-stained plate there was a crumpled envelope. It had contained something, since one edge was torn, but there was no address on it — nothing at all, save a phony armorial design with “Ponderosa Lodge” in green letters; thereupon I performed a chassé-croisé with Mary, who was in the act of bustling out again — wonderful how fast they move and how little they do, those rumpy young nurses. She glowered at the envelope I had put back, uncrumpled. “You better not touch,” she said, nodding directionally. “Could burn your fingers.” Below my dignity to rejoin. All I said was: “Je croyais que c’tait un bill — not a billet doux.” Then,enteringthesunnyroom,toLolita: “Bonjour, mon petit.” “Dolores,” said Mary Lore, entering with me, past me, though me, the plump whore, and blinking, and starting to fold very rapidly a white flannelblanketassheblinked: “Dolores, your pappy thinks you are getting letters from my boy friend. It’s me (smugly tapping herself on the small gilt cross she wore) gets them. And my pappy can parlay-voo as well as yours.” She left the room. Dolores, so rosy and russet, lips freshly painted, hair brilliantly brushed, bare arms straightened out on neat coverlet, lay innocently beaming at me or nothing. On the bed table, next to a paper napkin and a pencil, her topaz ring burned in the sun. Vladimir Nabokov — Lolita 161 “what gruesome funeral flowers,”shesaid.“Thanksallthesame.Butdoyoumindvery much cutting out the French? It annoys everybody.” Back at the usual rush came the ripe young hussy, reeking of urine and garlic, with the Deseret News, which her fair patient eagerly accepted, ignoring the sumptuously illustrated volumes I had brought. “My sister Ann,” said Marry (topping information with afterthought), “works at the Ponderosa place.” Poor Bluebeard. Thosebrutalbrothers.Est-ce que tu ne m’aimes plus, ma Carmen? She never had. At the moment I knew my love was as hopeless as ever — and I also knew the two girls were conspirators, plotting in Basque, or Zemfirian,againstmyhopeless love. I shall go further and say that Lo was playing a double game since she was also fooling sentimental Mary whom she had told, I suppose, that she wanted to dwell with her fun-loving young uncle and not with cruel melancholy me. And another nurse whom I never identified,andthevillageidiotwhocartedcotsandcoffinsinto the elevator, and the idiotic green love birds in a cage in the waiting room — all were in the plot, the sordid plot. I suppose Mary thought comedy father Professor Humbertoldi was interfering with the romance between Dolores and her father-substitute, roly-poly Romeo (for you were rather lardy, you know, Rom, despite all that “snow” and “joy juice”). My throat hurt. I stood, swallowing, at the window and stared at the mountains, at the romantic rock high up in the smiling plotting sky. “My Carmen,” I said (I used to call her that sometimes), “we shall leave this raw sore town as soon as you get out of bed.” “Incidentally, I want all my clothes,” said the gitanilla, humping up her knees and turning to another page. “…Because, really,” I continued, “there is no point in staying here.” “Thereisnopointinstayinganywhere,”saidLolita. I lowered myself into a cretonne chair and, opening the attractive botanical work, attempted, in the fever-humming hush of the room, to identify my flowers.Thisprovedimpossible. Presently a musical bell softly sounded somewhere in the passage. I do not think they had more than a dozen patients (three or four were lunatics, as Lo had cheerfully informed me earlier) in that show place of a hospital, and the staffhadtoomuchleisure.However—likewiseforreasonsofshow—regulationswere rigid. It is also true that I kept coming at the wrong hours. Not without a secret flowofdreamymalice, visionary Mary (next time it will be une belle dame toute en bleu floatingthroughRoaringGulch)pluckedmebythesleevetoleadmeout.Ilookedat her hand; it dropped. As I was leaving, leaving voluntarily, Dolores Haze reminded me to bring her next morning… She did not remember where the various things she wanted were… “Bring me,” she cried (out of sight already, door on the move, closing, closed), “the new gray suitcase and Mother’s trunk”; but by next morning I was shivering, and boozing, and dying nit he motel bed she had used for just a few minutes, and the best I could do under the circular and dilating circumstances was to send the two 162 Lolita — Vladimir Nabokov bags over with the widow’s beau, a robust and kindly trucker. I imagined Lo displaying her treasures to Mary… No doubt, I was a little delirious — and on the following day I was still a vibration rather than a solid, for when I looked out the bathroom window at the adjacent lawn, I saw Dolly’s beautiful young bicycle propped up there on its support, the graceful front wheel looking away from me, as it always did, and a sparrow perched on the saddle — but it was the landlady’s bike, and smiling a little, and shaking my poor head over my fond fancies, I tottered back to my bed, and lay as quiet as a saint — Saint, forsooth! While brown Dolores, On a patch of sunny green With Sanchicha reading stories In a movie magazine — — which was represented by numerous specimens wherever Dolores landed, and there was some great national celebration in town judging by the firecrackers,veritable bombs, that exploded all the time, and at fiveminutestotwop.m.Iheardthe sound of whistling lips nearing the half-opened door of my cabin, and then a thump upon it. It was big Frank. He remained framed in the opened door, one hand on its jamb, leaning forward a little. Howdy. Nurse Lore was on the telephone. She wanted to know was I better and would I come today? At twenty paces Frank used to look a mountain of health; at five,asnow,hewasa ruddy mosaic of scars — had been blown through a wall overseas; but despite nameless injuries he was able to man a tremendous truck, fish,hunt,drink,andbuoyantlydally with roadside ladies. Thatday,eitherbecauseitwassuchagreatholiday,orsimply because he wanted to divert a sick man, he had taken offthegloveheusually wore on his left hand (the one pressing against the side of the door) and revealed to the fascinated sufferernotonlyanentirelackoffourthandfifthfingers,but also a naked girl, with cinnabar nipples and indigo delta, charmingly tattooed on the back of his crippled hand, its index and middle digit making her legs while his wrist bore her flower-crownedhead.Oh,delicious…recliningagainstthewoodwork, like some sly fairy. I asked him to tell Mary Lore I would stay in bed all day and would get into touch with my daughter sometime tomorrow if I felt probably Polynesian. He noticed the direction of my gaze and made her right hip twitch amorously. “Okey-dokey,” big Frank sang out, slapped the jamb, and whistling, carried my message away, and I went on drinking, and by morning the fever was gone, and although I was as limp as a toad, I put on the purple dressing gown over my maize yellow pajamas, and walked over to the officetelephone.Everythingwasfine.Abrightvoiceinformed me that yes, everything was fine,mydaughterhadcheckedoutthedaybeVladimir Nabokov — Lolita 163 fore, around two, her uncle, Mr. Gustave, had called for her with a cocker spaniel pup and a smile for everyone, and a black Caddy Lack, and had paid Dolly’s bill in cash, and told them to tell me I should not worry, and keep warm, they were at Grandpa’s ranch as agreed. Elphinstone was, and I hope still is, a very cute little town. It was spread like a maquette, you know, with its neat greenwool trees and red-roofed houses over the valley floorandIthinkIhavealludedearliertoitsmodelschoolandtempleandspaciousrectangular blocks, some of which were, curiously enough, just unconventional pastures with a mule or a unicorn grazing in the young July morning mist. Very amusing: at one gravel-groaning sharp turn I sideswiped a parked car but said to myself telestically — and, telepathically (I hoped), to its gesticulating owner — that I would return later, address Bird School, Bird, New Bird, the gin kept my heart alive but bemazed my brain, and after some lapses and losses common to dream sequences, I found myself in the reception room, trying to beat up the doctor, and roaring at people under chairs, and clamoring for Mary who luckily for her was not there; rough hands plucked at my dressing gown, ripping offapocket,andsomehowIseemtohavebeensitting on a bald brown-headed patient, whom I had mistaken for Dr. Blue, and who eventually stood up, remarking with a preposterous accent: “Now, who is nevrotic, I ask?” — and then a gaunt unsmiling nurse presented me with seven beautiful, beautiful books and the exquisitely folded tartan lap robe, and demanded a receipt; and in the sudden silence I became aware of a policeman in the hallway, to whom my fellow motorist was pointing me out, and meekly I signed the very symbolic receipt, thus surrendering my Lolita to all those apes. But what else could I do? One simple and stark thought stood out and this was: “Freedom for the moment is everything.” One false move — and I might have been made to explain a life of crime. So I simulated a coming out of a daze. To my fellow motorist I paid what he thought was fair. To Dr. Blue, who by then was stroking my hand, I spoke in tears of the liquor I bolstered too freely a tricky but not necessarily diseased heart with. To the hospital in general I apologized with a flourishthatalmostbowledmeover,addinghoweverthatIwasnot on particularly good terms with the rest of the Humbert clan. To myself I whispered that I still had my gun, and was still a free man — free to trace the fugitive, free to destroy my brother. 23 A thousand-mile stretch of silk-smooth road separated Kasbeam, where, to the best of my belief, the red fiendhadbeenscheduledtoappearforthefirsttime,andfatefulElphinstone which we had reached about a week before Independence Day. Thejourney had taken up most of June for we had seldom made more than a hundred and fiftymilespertravelingday,spendingtherestofthetime,uptofivedaysinonecase,at various stopping places, all of them also prearranged, no doubt. It was that stretch, 164 Lolita — Vladimir Nabokov then, along which the fiend’sspoorshouldbesought;andtothisIdevotedmyself,after several unmentionable days of dashing up and down the relentlessly radiating roads in the vicinity of Elphinstone. Imagine me, reader , with my shyness, my distaste for any ostentation, my inherent sense of the comme il faut, imagine me masking the frenzy of my grief with a trembling ingratiating smile while devising some casual pretext to flipthroughthehotel register: “Oh,” I would say, “I am almost positive that I stayed here once — let me look up the entries for mid-June — no, I see I’m wrong after all — what a very quaint name for a home town, Kawtagain. Thanksverymuch.”Or:“Ihadacustomerstaying here — I mislaid his address — may I…?” And every once in a while, especially if the operator of the place happened to be a certain type of gloomy male, personal inspection of the books was denied me. I have a memo here: between July 5 and November ?8, when I returned to Beardsley for a few days, I registered, if not actually stayed, at 342 hotels, motels and tourist homes. Thisfigureincludesa fewregistrationsbetweenChestnutandBeardsley,one of which yielded a shadow of the fiend(“N.Petit,Larousse,Ill.”);Ihadtospaceand time my inquiries carefully so as not to attract undue attention; and there must have been at least fiftyplaceswhereImerelyinquiredatthedesk—butthatwasafutile quest, and I preferred building up a foundation of verisimilitude and good will by firstpayingforanunneededroom.Mysurveyshowedthatofthe300orsobooksinspected, at least 20 provided me with a clue: the loitering fiendhadstoppedevenmore often than we, or else — he was quite capable of that — he had thrown in additional registrations in order to keep me well furnished with derisive hints. Only in one case had he actually stayed at the same motor court as we, a few paces from Lolita’s pillow. In some instances he had taken up quarters in the same or in a neighboring block; not infrequently he had lain in wait at an intermediate spot between two bespoken points. How vividly I recalled Lolita, just before our departure from Beardsley, prone on the parlor rug, studying tour books and maps, and marking laps and stops with her lipstick! I discovered at once that he had foreseen my investigations and had planted insulting pseudonyms for my special benefit.AttheveryfirstmotelofficeIvisited,Ponderosa Lodge, his entry, among a dozen obviously human ones, read: Dr. Gratiano Forbeson, Mirandola, NY. Its Italian Comedy connotations could not fail to strike me, of course. Thelandladydeignedtoinformmethatthegentlemanhadbeenlaidup for fivedayswithabadcold,thathehadlefthiscarforrepairsinsomegarageorother and that he had checked out on the 4th of July. Yes, a girl called Ann Lore had worked formerly at the Lodge, but was now married to a grocer in Cedar City. One moonlit night I waylaid white-shoed Mary on a solitary street; an automaton, she was about to shriek, but I managed to humanize her by the simple act of falling on my knees and with pious yelps imploring her to help. She did not know a thing, she swore. Who was this Gratiano Forbeson? She seemed to waver. I whipped out a hundred-dollar bill. She lifted it to the light of the moon. “He is your brother,” she whispered Vladimir Nabokov — Lolita 165 at last. I plucked the bill out of her moon-cold hand, and spitting out a French curse turned and ran away. Thistaughtmetorelyonmyselfalone.Nodetectivecoulddiscover the clues Trapp had tuned to my mind and manner. I could not hope, of course, he would ever leave his correct name and address; but I did hope he might slip on the glaze of his own subtlety, by daring, say, to introduce a richer and more personal shot of color than strictly necessary, or by revealing too much through a qualitative sum of quantitative parts which revealed too little. In one thing he succeeded: he succeeded in thoroughly enmeshing me and my thrashing anguish in his demoniacal game. With infiniteskill,heswayedandstaggered,andregainedanimpossiblebalance, always leaving me with the sportive hope — if I may use such a term in speaking of betrayal, fury, desolation, horror and hate — that he might give himself away next time. He never did — though coming damn close to it. We all admire the spangled acrobat with classical grace meticulously walking his tight rope in the talcum light; but how much rarer art there is in the sagging rope expert wearing scarecrow clothes and impersonating a grotesque drunk! I should know. Thecluesheleftdidnotestablishhisidentitybuttheyreflectedhispersonality,or at least a certain homogenous and striking personality; his genre, his type of humor — at its best at least — the tone of his brain, had affinitieswithmyown.Hemimedand mocked me. His allusions were definitelyhighbrow.Hewaswell-read.HeknewFrench. he was versed in logodaedaly and logomancy. He was an amateur of sex lore. He had a feminine handwriting. He would change his name but he could not disguise, no matter how he slanted them, his very peculiar t’s, w’s and l’s. Quelquepart Island was one of his favorite residences. He did not use a fountain pen which fact, as any psychoanalyst will tell you, meant that the patient was a repressed undinist. One mercifully hopes there are water nymphs in the Styx. His main trait was his passion for tantalization. Goodness, what a tease the poor fellow was! He challenged my scholarship. I am sufficientlyproudofmyknowingsomething to be modest about my not knowing all; and I daresay I missed some elements in that cryprogrammic paper chase. What a shiver of triumph and loathing shook my frail frame when, among the plain innocent names in the hotel recorder, his fiendishconundrumwouldejaculateinmyface!Inoticedthatwheneverhefelthis enigmas were becoming too recondite, even for such a solver as I, he would lure me back with an easy one. “Arsène Lupin” was obvious to a Frenchman who remembered the detective stories of his youth; and one hardly had to be a Coleridgian to appreciate the trite poke of “A. Person, Porlock, England.” In horrible taste but basically suggestive of a cultured man — not a policeman, not a common good, not a lewd salesman — were such assumed names as “Arthur Rainbow” — plainly the travestied author of Le Bateau Bleu — let me laugh a little too, gentlemen — and “Morris Schmetterling,” of L’Oiseau Ivre fame (touché, reader!). Thesillybutfunny“D.Orgon,Elmira, NY,” was from Molière, of course, and because I had quite recently tried to interest Lolita in a famous ?8th-century play, I welcomed as an old friend “Harry Bumper, Sheridan, Wyo.” An ordinary encyclopedia informed me who the peculiar 166 Lolita — Vladimir Nabokov looking “Phineas Quimby, Lebanon, NH” was; and any good Freudian, with a German name and some interest in religious prostitution, should recognize at a glance the implication of “Dr. Kitzler, Eryx, Miss.” So far so good. Thatsortoffunwasshoddy but on the whole impersonal and thus innocuous. Among entries that arrested my attention as undoubtable clues per se but baffledmeinrespecttotheirfinerpoints I do not care to mention many since I feel I am groping in a border-land mist with verbal phantoms turning, perhaps, into living vacationists. Who was “Johnny Randall, Ramble, Ohio”? Or was he a real person who just happened to write a hand similar to “N.S. Aristoff,Catagela,NY”?Whatwasthestingin“Catagela”?Andwhat about “James Mavor Morell, Hoaxton, England”? “Aristophanes,” “hoax” — fine,but what was I missing? Therewasonestrainrunningthroughallthatpseudonymitywhichcausedmeespecially painful palpitations when I came across it. Such things as “G. Trapp, Geneva, NY.” was the sign of treachery on Lolita’s part. “Aubrey Beardsley, Quelquepart Island” suggested more lucidly than the garbled telephone message had that the starting point of the affairshouldbelookedforintheEast.“LucasPicador,Merrymay,Pa.” insinuated that my Carmen had betrayed my pathetic endearments to the impostor. Horribly cruel, forsooth, was “Will Brown, Dolores, Colo.” Thegruesome“Harold Haze, Tombstone, Arizona” (which at another time would have appealed to my sense of humor) implied a familiarity with the girl’s past that in nightmare fashion suggested for a moment that my quarry was an old friend of the family, maybe an old flameofCharlotte’s,maybearedresserofwrongs(“DonaldQuix,Sierra,Nev.”).Butthe most penetrating bodkin was the anagramtailed entry in the register of Chestnut Lodge “Ted Hunter, Cane, NH.” ThegarbledlicensenumbersleftbyallthesePersonsandOrgonsandMorellsandTrapps only told me that motel keepers omit to check if guests’ cars are accurately listed. References — incompletely or incorrectly indicated — to the cars the fiendhadhired for short laps between Wace and Elphinstone were of course useless; the license of the initial Aztec was a shimmer of shifting numerals, some transposed, others altered or omitted, but somehow forming interrelated combinations (such as “WS ?564” and “SH ?6?6,” and “Q32888” or “CU88322”) which however were so cunningly contrived as to never reveal a common denominator. It occurred to me that after he had turned that convertible over to accomplices at Wace and switched to the stage-motor car system, his successors might have been less careful and might have inscribed at some hotel officethearchtypeofthoseinterrelated figures.Butiflookingforthefiendalonga roadI knewhehadtakenwassucha complicated vague and unprofitablebusiness,whatcouldIexpectfromanyattemptto trace unknown motorists traveling along unknown routes? Vladimir Nabokov — Lolita 167 24 By the time I reached Beardsley, in the course of the harrowing recapitulation I have now discussed at sufficientlength,a completeimagehadformedinmymind; and through the — always risky — process of elimination I had reduced this image to the only concrete source that morbid cerebration and torpid memory could give it. Except for the Rev. Rigor Mortis (as the girls called him), and an old gentleman who taught non-obligatory German and Latin, there were no regular male teachers at Beardsley School. But on two occasions an art instructor on the Beardsley College faculty had come over to show the schoolgirls magic lantern pictures of French castles and nineteenth-century paintings. I had wanted to attend those projections and talks, but Dolly, as was her wont, had asked me not to, period. I also remembered that Gaston had referred to that particular lecturer as a brilliant garçon; but that was all; memory refused to supply me with the name of the chateau-lover. On the day fixedfortheexecution,Iwalkedthoughthesleetacrossthecampus to the information desk in Maker Hall, Beardsley College. ThereIlearnedthatthe fellow’s name was Riggs (rather like that of the minister), that he was a bachelor, and that in ten minutes he would issue from the “Museum” where he was having a class. In the passage leading to the auditorium I sat on a marble bench of sorts donated by Cecilia Dalrymple Ramble. As I waited there, in the prostatic discomfort, drunk, sleep-starved, with my gun in my fistinmyraincoatpocket,itsuddenlyoccurred to me that I was demented and was about to do something stupid. Therewas not one chance in a million that Albert Riggs, Ass. Prof., was hiding my Lolita at his Beardsley home, 24 Pritchard Road. He could not be the villain. It was absolutely preposterous. I was losing my time and my wits. He and she were in California and not here at all. Presently, I noticed a vague commotion behind some white statues; a door — not the one I had been staring at — opened briskly, and amid a bevy of women students a baldish head and two bright brown eyes bobbed, advanced. He was a total stranger to me but insisted we had met at a lawn party at Beardsley School. How was my delightful tennis-playing daughter? He had another class. He would be seeing me. Another attempt at identificationwaslessspeedilyresolved:throughanadvertisement in one of Lo’s magazines I dared to get in touch with a private detective, an ex-pugilist, and merely to give him some idea of the method adopted by the fiend,I acquainted him with the kind of names and addresses I had collected. He demanded a goodish deposit and for two years — two years, reader! — that imbecile busied himself with checking those nonsense data. I had long severed all monetary relations with him when he turned up one day with the triumphant information that an eighty-year-old Indian by the name of Bill Brown lived near Dolores, Colo. 168 Lolita — Vladimir Nabokov 25 ThisbookisaboutLolita;andnowthatIhavereachedthepartwhich(hadInotbeenforestalled by another internal combustion martyr) might be called “Dolorès Disparue,” there would be little sense in analyzing the three empty years that followed. While a few pertinent points have to be marked, the general impression I desire to convey is of a side door crashing open in life’s full flight,andarushofroaringblacktimedrowning with its whipping wind the cry of lone disaster. Singularly enough, I seldom if ever dreamed of Lolita as I remembered her — as I saw her constantly and obsessively in my conscious mind during my daymares and insomnias. More precisely: she did haunt my sleep but she appeared there in strange and ludicrous disguises as Valeria or Charlotte, or a cross between them. Thatcomplex ghost would come to me, shedding shift after shift, in an atmosphere of great melancholy and disgust, and would recline in dull invitation on some narrow board or hard settee, with fleshajarliketherubbervalveofasoccerball’sbladder.Iwouldbind myself, dentures fractured or hopelessly mislaid, in horrible chambres garnies where I would be entertained at tedious vivisecting parties that generally ended with Charlotte or Valeria weeping in my bleeding arms and being tenderly kissed by my brotherly lips in a dream disorder of auctioneered Viennese bric-à-brac, pity, impotence and the brown wigs of tragic old women who had just been gassed. One day I removed from the car and destroyed an accumulation of teen-magazines. You know the sort. Stone age at heart; up to date, or at least Mycenaean, as to hygiene. A handsome, very ripe actress with huge lashes and a pulpy red underlip, endorsing a shampoo. Ads and fads. Young scholars dote on plenty of pleats — que c’était loin, tout cela! It is your hostess’ duty to provide robes. Unattached details take all the sparkle out of your conversation. All of us have known “pickers” — one who picks her cuticle at the officeparty.Unlessheisveryelderlyorveryimportant,amanshouldremovehisglovesbefore shaking hands with a woman. Invite Romance by wearing the Exciting New Tummy Flattener. Trims tums, nips hips. Tristram in Movielove. Yessir! TheJoe-Roemarital enigma is making yaps flap.Glamorizeyourselfquicklyandinexpensively.Comics. Bad girl dark hair fat father cigar; good girl red hair handsome daddums clipped mustache. Or that repulsive strip with the big gagoon and his wife, a kiddoid gnomide. Et moi qui t’offraismongénie… I recalled the rather charming nonsense verse I used to write her when she was a child: “nonsense,” she used to say mockingly, “is correct.” TheSquirlandhisSquirrel,theRabsandtheirRabbits Have certain obscure and peculiar habits. Male hummingbirds make the most exquisite rockets. Thesnakewhenhewalksholdshishandsinhispockets… Other things of hers were harder to relinquish. Up to the end of ?949, I cherished and adored, and stained with my kisses and merman tears, a pair of old sneakers, Vladimir Nabokov — Lolita 169 a boy’s shirt she had worn, some ancient blue jeans I found in the trunk compartment, a crumpled school cap, suchlike wanton treasures. Then,whenIunderstoodmymind was cracking, I collected those sundry belongings, added to them what had been stored in Beardsley — a box of books, her bicycle, old coats, galoshes — and on her fifteenth birthday mailed everything as an anonymous gift to a home for orphaned girls on a windy lake, on the Canadian border. It is just possible that had I gone to a strong hypnotist he might have extracted from me and arrayed in a logical pattern certain chance memories that I have threaded through my book with considerably more ostentation than they present themselves with to my mind even now when I know what to seek in the past. At the time I felt I was merely losing contact with reality; and after spending the rest of the winter and most of the following spring in a Quebec sanatorium where I had stayed before, I resolved firsttosettlesomeaffairsofmineinNewYorkandthentoproceedtoCalifornia for a thorough search there. Here is something I composed in my retreat: Wanted, wanted: Dolores Haze. Hair: brown. Lips: scarlet. Age: fivethousandthreehundreddays. Profession: none, or “starlet.” Where are you hiding, Dolores Haze? Why are you hiding, darling? (I talk in a daze, I walk in a maze, I cannot get out, said the starling). Where are you riding, Dolores Haze? What make is the magic carpet? Is a Cream Cougar the present craze? And where are you parked, my car pet? Who is your hero, Dolores Haze? Still one of those blue-caped star-men? Oh the balmy days and the palmy bays, And the cars, and the bars, my Carmen! Oh Dolores, that juke-box hurts! Are you still dancin’, darlin’? (Both in worn levis, both in torn T-shirts, And I, in my corner, snarlin’). 170 Lolita — Vladimir Nabokov Happy, happy is gnarled McFate Touring the States with a child wife, Plowing his Molly in every State Among the protected wild life. My Dolly, my folly! Her eyes were vair, And never closed when I kissed her. Know an old perfume called Soleil Vert? Are you from Paris, mister? L’autre soir un air froid d’opéra m’alita: Son félé — bien fol est qui s’y fie! Il neige, le décor s’écroule, Lolita! Lolita, qu’ai — je fait de ta vie? Dying, dying, Lolita Haze, Of hate and remorse, I’m dying. And again my hairy fistIraise, And again I hear you crying. Officer,officer,theretheygo— In the rain, where that lighted store is! And her socks are white, and I love her so, And her name is Haze, Dolores. Officer,officer,theretheyare — Dolores Haze and her lover! Whip out your gun and follow that car. Now tumble out, and take cover. Wanted, wanted: Dolores Haze. Her dream-gray gaze never flinches. Ninety pounds is all she weighs With a height of sixty inches. My car is limping, Dolores Haze, And the last long lap is the hardest, And I shall be dumped where the weed decays, And the rest is rust and stardust. By psychoanalyzing this poem, I notice it is really a maniac’s masterpiece. Thestark,stiff,luridrhymescorrespondveryexactlytocertainperspectivelessandterriblelandVladimir Nabokov — Lolita 171 scapes and figures,andmagnifiedpartsoflandscapesandfigures,as drawnby psychopaths in tests devised by their astute trainers. I wrote many more poems. I immersed myself in the poetry of others. But not for a second did I forget the load of revenge. I would be a knave to say, and the reader a fool to believe, that the shock of losing Lolita cured me of pederosis. My accursed nature could not change, no matter how my love for her did. On playgrounds and beaches, my sullen and stealthy eye, against my will, still sought out the flashofanymphet’slimbs,theslytokensofLolita’shandmaids and rosegirls. But one essential vision in me had withered: never did I dwell now on possibilities of bliss with a little maiden, specificorsynthetic,insomeout-of-the-way place; never did my fancy sink its fangs into Lolita’s sisters, far far away, in the coves of evoked islands. That was all over, for the time being at least. On the other hand, alas, two years of monstrous indulgence had left me with certain habits of lust: I feared lest the void I lived in might drive me to plunge into the freedom of sudden insanity when confronted with a chance temptation in some lane between school and supper. Solitude was corrupting me. I needed company and care. My heart was a hysterical unreliable organ. ThisishowRitaentersthepicture. 26 She was twice Lolita’s age and three quarters of mine: a very slight, dark-haired, pale-skinned adult, weighing a hundred and fivepounds,withcharminglyasymmetricaleyes, and angular, rapidly sketched profile,andamostappealingensellure to her supple back — I think she had some Spanish or Babylonian blood. I picked her up one depraved May evening somewhere between Montreal and New York, or more narrowly, between Toylestown and Blake, at a darkishly burning bar under the sign of the Tigermoth, where she was amiably drunk: she insisted we had gone to school together, and she placed her trembling little hand on my ape paw. My senses were very slightly stirred but I decided to give her a try; I did — and adopted her as a constant companion. She was so kind, was Rita, such a good sport, that I daresay she would have given herself to any pathetic creature or fallacy, an old broken tree or a bereaved porcupine, out of sheer chumminess and compassion. When I firstmethershehadbutrecentlydivorcedherthirdhusband—andalittle more recently had been abandoned by her seventh cavalier servant — the others, the mutables, were too numerous and mobile to tabulate. Her brother was — and no doubt still is — a prominent, pasty-faced, suspenders-and-painted-tie-wearing politician, mayor and booster of his ball-playing, Bible-reading, grain-handling home town. For the last eight years he had been paying his great little sister several hundred dollars per month under the stringent condition that she would never never enter great little Grainball City. She told me, with wails of wonder, that for some God-damn reason every new boy friend of hers would firstofalltakeherGrainball-ward: it was a fatal attraction; and before she knew what was what, she would find 172 Lolita — Vladimir Nabokov herself sucked into the lunar orbit of the town, and would be following the flood-lit drive that encircled it — “going round and round,” as she phrased it, “like a God-damn mulberry moth.” She had a natty little coupé; and in it we traveled to California so as to give my venerable vehicle a rest. her natural speed was ninety. Dear Rita! We cruised together for two dim years, from summer ?950 to summer ?952, and she was the sweetest, simplest, gentles, dumbest Rita imaginable. In comparison to her, Valechka was a Schlegel, and Charlotte a Hegel. ThereisnoearthlyreasonwhyIshoulddallywithherinthe margin of this sinister memoir, but let me say (hi, Rita — wherever you are, drunk or hangoverish, Rita, hi!) that she was the most soothing, the most comprehending companion that I ever had, and certainly saved me from the madhouse. I told her I was trying to trace a girl and plug that girl’s bully. Rita solemnly approved of the plan — and in the course of some investigation she undertook on her own (without really knowing a thing), around San Humbertino, got entangled with a pretty awful crook herself; I had the devil of a time retrieving her — used and bruised but still cocky. ThenonedaysheproposedplayingRussianroulettewithmysacredautomatic;I said you couldn’t, it was not a revolver, and we struggled for it, until at last it went off,touching offaverythinandverycomicalspurtofhotwaterfromtheholeitmadeinthe wall of the cabin room; I remember her shrieks of laughter. Theoddlyprepubescentcurveofherback,herriceyskin,herslowlanguorouscolumbine kisses kept me from mischief. It is not the artistic aptitudes that are secondary sexual characters as some shams and shamans have said; it is the other way around: sex is but the ancilla of art. One rather mysterious spree that had interesting repercussions I must notice. I had abandoned the search: the fiendwaseitherin Tartary or burning away in my cerebellum (the flamesfannedbymyfancyandgrief) but certainly not having Dolores Haze play champion tennis on the PacificCoast. One afternoon, on our way back East, in a hideous hotel, the kind where they hold conventions and where labeled, fat, pink men stagger around, all firstnames and business and booze — dear Rita and I awoke to findathirdinourroom,a blond, almost albino, young fellow with white eyelashes and large transparent ears, whom neither Rita nor I recalled having ever seen in our sad lives. Sweating in thick dirty underwear, and with old army boots on, he lay snoring on the double bed beyond my chaste Rita. One of his front teeth was gone, amber pustules grew on his forehead. Ritochka enveloped her sinuous nudity in my raincoat — the firstthing at hand; I slipped on a pair of candy-striped drawers; and we took stock of the situation. Five glasses had been used, which in the way of clues, was an embarrassment of riches. Thedoorwasnotproperlyclosed.Asweaterandapairofshapeless tan pants lay on the floor.Weshooktheirownerintomiserableconsciousness.He was completely amnesic. In an accent that Rita recognized as pure Brooklynese, he peevishly insinuated that somehow we had purloined his (worthless) identity. We rushed him into his clothes and left him at the nearest hospital, realizing on the way that somehow or other after forgotten gyrations, we ewer in Grainball. Vladimir Nabokov — Lolita 173 Half a year later Rita wrote the doctor for news. Jack Humbertson as he had been tastelessly dubbed was still isolated from his personal past. Oh Mnemosyne, sweetest and most mischievous of muses! I would not have mentioned this incident had it not started a chain of ideas that resulted in my publishing in the Cantrip Review an essay on “Mimir and Memory,” in which I suggested among other things that seemed original and important to that splendid review’s benevolent readers, a theory of perceptual time based on the circulation of the blood and conceptually depending (to fillupthisnutshell)onthe mind’s being conscious not only of matter but also of its own self, thus crating a continuous spanning of two points (the storable future and the stored past). In result of this venture — and in culmination of the impression made by my previous travaux — I was called from New York, where Rita and I were living in a little flatwitha view of gleaming children taking shower baths far below in a fountainous arbor of Central Park, to Cantrip College, four hundred miles away, for one year. I lodged there, in special apartments for poets and philosophers, from September ?95? to June ?952, while Rita whom I preferred not to display vegetated — somewhat indecorously, I am afraid — in a roadside inn where I visited her twice a week. Thenshevanished—morehumanly than her predecessor had done: a month later I found her in the local jail. She was très digne, had had her appendix removed, and managed to convince me that the beautiful bluish furs she had been accused of stealing from a Mrs. Roland MacCrum had really been a spontaneous, if somewhat alcoholic, gift from Roland himself. I succeeded in getting her out without appealing to her touchy brother, and soon afterwards we drove back to Central Park West, by way of Briceland, where we had stopped for a few hours the year before. A curious urge to relive my stay there with Lolita had got hold of me. I was entering a phase of existence where I had given up all hope of tracing her kidnapper and her. I now attempted to fall back on old settings in order to save what still could be saved in the way of souvenir, souvenir que me veux-tu? Autumn was ringing in the air. To a post card requesting twin beds Professor Hamburg got a prompt expression of regret in reply. Theywerefullup.Theyhadonebathlessbasementroomwithfourbedswhich they thought I would not want. Theirnotepaperwasheaded: TheEnchantedHunters NEAR CHURCHES NO DOGS All legal beverages I wondered if the last statement was true. All? Did they have for instance sidewalk grenadine? I also wondered if a hunter, enchanted or otherwise, would not need a pointer more than a pew, and with a spasm of pain I recalled a scene worthy of a great artist: petite nymphe accroupie; but that silky cocker spaniel had perhaps been a baptized one. No — I felt I could not endure the throes of revisiting that lobby. Therewas a much better possibility of retrievable time elsewhere in soft, rich-colored, au174 Lolita — Vladimir Nabokov tumnal Briceland. Leaving Rita in a bar, I made for the town library. A twittering spinster was only too glad to help me disinter mid-August ?947 from the bound Briceland Gazette, and presently, in a secluded nook under a naked light, I was turning the enormous and fragile pages of a coffin-blackvolumealmostasbigasLolita. Reader! Bruder! What a foolish Hamburg that Hamburg was! Since his supersensitive system was loath to face the actual scene, he thought he could at least enjoy a secret part of it — which reminds one of the tenth or twentieth soldier in the raping queue who throws the girl’s black shawl over her white face so as not to see those impossible eyes while taking his military pleasure in the sad, sacked village. What I lusted to get was the printed picture that had chanced to absorb my trespassing image while the Gazette’s photographer was concentrating on Dr. Braddock and his group. Passionately I hoped to findpreservedtheportraitoftheartistasayoungerbrute.Aninnocent camera catching me on my dark way to Lolita’s bed — what a magnet for Mnemosyne! I cannot well explain the true nature of that urge of mine. It was allied, I suppose, to that swooning curiosity which impels one to examine with a magnifying glass bleak little figures—stilllifepractically,andeverybodyabouttothrowup—atan early morning execution, and the patient’s expression impossible to make out in the print. Anyway, I was literally gasping for breath, and one corner of the book of doom kept stabbing me in the stomach while I scanned and skimmed… Brute Force and Possessed were coming on Sunday, the 24th, to both theatres. Mr. Purdom, independent tobacco auctioneer, said that ever since ?925 he had been an Omen Faustum smoker. Husky Hank and his petite bride were to be the guests of Mr. and Mrs. Reginald G. Gore, 58 Inchkeith Ave. Thesizeofcertainparasitesisonesixthofthehost.Dunkerque was fortifiedinthetenthcentury.Misses’socks,39c.SaddleOxfords3.98.Wine, wine, wine, quipped the author of Dark Age who refused to be photographed, may suit a Persian bubble bird, but I say give me rain, rain, rain on the shingle roof for roses and inspiration every time. Dimples are caused by the adherence of the skin to the deeper tissues. Greeks repulse a heavy guerrilla assault — and, ah, at last, a little figureinwhite,andDr.Braddockinblack,butwhateverspectralshoulderwasbrushing against his ample form — nothing of myself could I make out. I went to findRitawhointroducedmewithhervin triste smile to a pocket-sized wizened truculently tight old man saying this was — what was the name again, son? — a former schoolmate of hers. He tried to retain her, and in the slight scufflethat followed I hurt my thumb against his hard head. In the silent painted part where I walked her and aired her a little, she sobbed and said I would soon, soon leave her as everybody had, and I sang her a wistful French ballad, and strung together some fugitive rhymes to amuse her: TheplacewascalledEnchanted Hunters. Query: What Indian dyes, Diana, did thy dell endorses to make of Picture Lake a very blood bath of trees before the blue hotel? Vladimir Nabokov — Lolita 175 She said: “Why blue when it is white, why blue for heaven’s sake?” and started to cry again, and I marched her to the car, and we drove on to New York, and soon she was reasonably happy again high up in the haze on the little terrace of our flat.I notice I have somehow mixed up two events, my visit with Rita to Briceland on our way to Carntrip, and our passing through Briceland again on our way back to New York, but such suffusionsofswimmingcolorsarenottobedisdainedbytheartistinrecollection. 27 My letterbox in the entrance hall belonged to the type that allows one to glimpse something of its contents through a glassed slit. Several times already, a trick of harlequin light that fell through the glass upon an alien handwriting had twisted it into a semblance of Lolita’s script causing me almost to collapse as I leant against an adjacent urn, almost my own. Whenever that happened — whenever her lovely, childish scrawl was horribly transformed into the dull hand of one of my few correspondents — I used to recollect, with anguished amusement, the times in my trustful, pre-dolorian past when I would be misled by a jewel-bright window opposite wherein my lurking eye, the ever alert periscope of my shameful vice, would make out from afar a half-naked nymphet stilled in the act of combing her Alice-in-Wonderland hair. Therewasinthefieryphantasm a perfection which made my wild delight also perfect, just because the vision was out of reach, with no possibility of attainment to spoil it by the awareness of an appended taboo; indeed, it may well be that the very attraction immaturity has for me lies not so much in the limpidity of pure young forbidden fairy child beauty as in the security of a situation where infiniteperfectionsfillthegapbetweenthelittlegivenand the great promised — the great rosegray never-to-be-had. Mes fenêtres! Hanging above blotched sunset and welling night, grinding my teeth, I would crowd all the demons of my desire against the railing of a throbbing balcony: it would be ready to take offintheapricotandblackhumidevening;didtakeoff— whereuponthelightedimagewould move and Even would revert to a rib, and there would be nothing in the window but an obese partly clad man reading the paper. Since I sometimes won the race between my fancy and nature’s reality, the deception was bearable. Unbearable pain began when chance entered the fray and deprived me of the smile meant for me. “Savez-vous qu’à dix ans ma petite était folle de vous?” said a woman I talked to at a tea in Paris, and the petite had just married, miles away, and I could not even remember if I had ever noticed her in that garden, next to those tennis courts, a dozen years before. And now likewise, the radiant foreglimpse, the promise of reality, a promise not only to be simulated seductively but also to be nobly held — all this, chance denied me — chance and a change to smaller characters on the pale beloved writer’s part. My fancy was both Proustianized and Procrusteanized; for that particular morning, late in September ?952, as I had come down to grope for 176 Lolita — Vladimir Nabokov my mail, the dapper and bilious janitor with whom I was on execrable terms started to complain that a man who had seen Rita home recently had been “sick like a dog” on the front steps. In the process of listening to him and tipping him, and then listening to a revised and politer version of the incident, I had the impression that one of the two letters which that blessed mail brought was from Rita’s mother, a crazy little woman, whom we had once visited on Cape Cod and who kept writing me to my various addresses, saying how wonderfully well matched her daughter and I were, and how wonderful it would be if we married; the other letter which I opened and scanned rapidly in the elevator was from John Farlow. I have often noticed that we are inclined to endow our friends with the stability of type that literary characters acquire in the reader’s mind. No matter how many times we reopen “King Lear,” never shall we findthegoodkingbanginghistankardinhighrevelry, all woes forgotten, at a jolly reunion with all three daughters and their lapdogs. Never will Emma rally, revived by the sympathetic salts in Flaubert’s father’s timely tear. Whatever evolution this or that popular character has gone through between the book covers, his fate is fixedinourminds,and,similarly,weexpectourfriendstofollow this or that logical and conventional pattern we have fixedforthem.ThusX willnever compose the immortal music that would clash with the second-rate symphonies he has accustomed us to. Y will never commit murder. Under no circumstances can Z ever betray us. We have it all arranged in our minds, and the less often we see a particular person the more satisfying it is to check how obediently he conforms to our notion of him every time we hear of him. Any deviation in the fates we have ordained would strike us as not only anomalous but unethical. We would prefer not to have known at all our neighbor, the retired hot-dog stand operator, if it turns out he has just produced the greatest book of poetry his age has seen. I am saying all this in order to explain how bewildered I was by Farlow’s hysterical letter. I knew his wife had died but I certainly expected him to remain, throughout a devout widowhood, the dull, sedate and reliable person he had always been. Now he wrote that after a brief visit to the U.S. he had returned to South America and had decided that whatever affairshehadcontrolledatRamsdalehewouldhandovertoJack Windmuller of that town, a lawyer whom we both knew. He seemed particularly relieved to get rid of the Haze “complications.” He had married a Spanish girl. He had stopped smoking and had gained thirty pounds. She was very young and a ski champion. TheyweregoingtoIndiafortheirhoneymonsoon.Sincehewas“building a family” as he put it, he would have no time henceforth for my affairswhichhetermed “very strange and very aggravating.” Busybodies — a whole committee of them, it appeared — had informed him that the whereabouts of little Dolly Haze were unknown, and that I was living with a notorious divorcee in California. His father-in-law was a count, and exceedingly wealthy. ThepeoplewhohadbeenrentingtheHazehouse for some years now wished to buy it. He suggested that I better produce Dolly quick. he had broken his leg. He enclosed a snapshot of himself and a brunette in white wool beaming at each other among the snows of Chile. Vladimir Nabokov — Lolita 177 I remember letting myself into my flatandstartingtosay:Well,atleastweshallnow track them down — when the other letter began talking to me in a small matter-of-fact voice: Dear Dad: How’s everything? I’m married. I’m going to have a baby. I guess he’s going to be a big one. I guess he’ll come right for Christmas. Thisisahardlettertowrite.I’mgoingnuts because we don’t have enough to pay our debts and get out of here. Dick is promised a big job in Alaska in his very specialized corner of the mechanical field,that’sallI know about it but it’s really grand. Pardon me for withholding our home address but you may still be mad at me, and Dick must not know. Thistownissomething.Youcan’tsee the morons for the smog. Please do send us a check, Dad. We could manage with three or four hundred or even less, anything is welcome, you might sell my old things, because once we go there the dough will just start rolling in. Writ, please. I have gone through much sadness and hardship. Yours expecting, Dolly (Mrs. Richard F. Schiller) 28 I was again on the road, again at the wheel of the old blue sedan, again alone. Rita had still been dead to the world when I read that letter and fought the mountains of agony it raised within me. I had glanced at her as she smiled in her sleep and had kissed her on her moist brow, and had left her forever, with a note of tender adieu which I taped to her navel — otherwise she might not have found it. “Alone” did I say? Pas tout à fait. I had my little black chum with me, and as soon as I reached a secluded spot, I rehearsed Mr. Richard F. Schiller’s violent death. I had found a very old and very dirty gray sweater of mine in the back of the car, and this I hung up on a branch, in a speechless glade, which I had reached by a wood road from the now remote highway. Thecarryingoutofthesentencewasalittlemarredby what seemed to me a certain stiffnessintheplayofthetrigger,andIwonderedif I should get some oil for the mysterious thing but decided I had no time to spare. Back into the car went the old dead sweater, now with additional perforations, and having reloaded warm Chum, I continued my journey. TheletterwasdatedSeptember?8,?952(thiswasSeptember22),andtheaddressshe gave was “General Delivery, Coalmont” (not “Va.,” not “Pa.,” not “Tenn.” — and not Coalmont, anyway — I have camouflagedeverything,mylove).Inquiriesshowedthis to be a small industrial community some eight hundred miles from New York City. At firstIplannedtodrivealldayandallnight,butthenthoughtbetterofitand rested for a couple of hours around dawn in a motor court room, a few miles before reaching the town. I had made up my mind that the fiend,thisSchiller,had 178 Lolita — Vladimir Nabokov been a car salesman who had perhaps got to know my Lolita by giving her a ride in Beardsley — the day her bike blew a tire on the way to Miss Emperor — and that he had got into some trouble since then. Thecorpseoftheexecutedsweater,nomatterhow I changed its contours as it lay on the back seat of the car, had kept revealing various outlines pertaining to Trapp-Schiller — the grossness and obscene bonhomie of his body, and to counteract this taste of coarse corruption I resolved to make myself especially handsome and smart as I pressed home the nipple of my alarm clock before it exploded at the set hour of six a.m. Then,withthesternandromanticcareof a gentleman about to fightaduel,Icheckedthearrangementofmypapers,bathedand perfumed my delicate body, shaved my face and chest, selected a silk shirt and clean drawers, pulled on transparent taupe socks, and congratulated myself for having with me in my trunk some very exquisite clothes — a waistcoat with nacreous buttons, for instance, a pale cashmere tie and so on. I was not able, alas, to hold my breakfast, but dismissed that physicality as a trivial contretemps, wiped my mouth with a gossamer handkerchief produced from my sleeve, and, with a blue block of ice for heart, a pill on my tongue and solid death in my hip pocket, I stepped neatly into a telephone booth in Coalmont (Ah-ah-ah, said its little door) and rang up the only Schiller — Paul, Furniture — to be found in the battered book. Hoarse Paul told me he did know a Richard, the son of a cousin of his, and his address was, let me see, ?0 Killer Street (I am not going very far for my pseudonyms). Ah-ah-ah, said the little door. At ?0 Killer Street, a tenement house, I interviewed a number of dejected old people and two long-haired strawberry-blond incredibly grubby nymphets (rather abstractly, just for the heck of it, the ancient beast in me was casting about for some lightly clad child I might hold against me for a minute, after the killing was over and nothing mattered any more, and everything was allowed). Yes, Dick Skiller had lived there, but had moved when he married. Nobody knew his address. “Theymightknowat the store,” said a bass voice from an open manhole near which I happened to be standing with the two thin-armed, barefoot little girls and their dim grandmothers. I entered the wrong store and a wary old Negro shook his head even before I could ask anything. I crossed over to a bleak grocery and there, summoned by a customer at my request, a woman’s voice from some wooden abyss in the floor,themanhole’scounterpart, cried out: Hunter Road, last house. Hunter Road was miles away, in an even more dismal district, all dump and ditch, and wormy vegetable garden, and shack, and gray drizzle, and red mud, and several smoking stacks in the distance. I stopped at the last “house” — a clapboard shack, with two or three similar ones farther away from the road and a waste of withered weeds all around. Sounds of hammering came from behind the house, and for several minutes I sat quite still in my old car, old and frail, at the end of my journey, at my gray goal, finis, my friends, finis, my friends. Thetimewasaroundtwo.Mypulse was 40 one minute and ?00 the next. Thedrizzlecrepitatedagainstthehoodof the car. My gun had migrated to my right trouser pocket. A nondescript cur Vladimir Nabokov — Lolita 179 came out from behind the house, stopped in surprise, and started good-naturedly woof-woofingatme,hiseyesslit,hisshaggybellyallmuddy,andthenwalkedabouta little and woofed once more. 29 I got out of the car and slammed its door. How matter-of-fact, how square that slam sounded in the void of the sunless day! Woof, commented the dog perfunctorily. I pressed the bell button, it vibrated through my whole system. Personne. Je resonne. Repersonne. From what depth this re-nonsense? Woof, said the dog. A rush and a shuffle,andwoosh-woofwentthedoor. Couple of inches taller. Pink-rimmed glasses. New, heaped-up hairdo, new ears. How simple! Themoment,thedeathIhadkeptconjuringupforthreeyearswasassimple as a bit of dry wood. She was frankly and hugely pregnant. Her head looked smaller (only two seconds had passed really, but let me give them as much wooden duration as life can stand), and her pale-freckled cheeks were hollowed, and her bare shins and arms had lost all their tan, so that the little hairs showed. She wore a brown, sleeveless cotton dress and sloppy felt slippers. “We — e — ell!” she exhaled after a pause with all the emphasis of wonder and welcome. “Husband at home?” I croaked, fistinpocket. I could not kill her, of course, as some have thought. You see, I loved her. It was love at firstsight,atlastsight,ateverandeversight. “Come in,” she said with a vehement cheerful note. Against the splintery deadwood of the door, Dolly Schiller flattenedherselfasbestshecould(evenrisingontiptoea little) to let me pass, and was crucifiedforamoment,lookingdown,smilingdownat the threshold, hollow-cheeked with round pommettes, her watered-milk-white arms outspread on the wood. I passed without touching her bulging babe. Dolly-smell, with a faint fried addition. My teeth chattered like an idiot’s. “No, you stay out” (to the dog). She closed the door and followed me and her belly into the dollhouse parlor. “Dick’s down there,” she said pointing with an invisible tennis racket, inviting my gaze to travel from the drab parlor-bedroom where we stood, right across the kitchen, and through the back doorway where, in a rather primitive vista, a dark-haired young stranger in overalls, instantaneously reprieved, was perched with his back to me on a ladder fixingsomethingnearorupontheshackofhisneighbor,aplumperfellowwith only one arm, who stood looking up. Thispatternsheexplainedfromafar,apologetically(“Menwillbemen”);shouldshe call him in? No. Standing in the middle of the slanting room and emitting questioning “hm’s,” she made familiar Javanese gestures with her wrists and hands, offeringme,inabriefdis180 Lolita — Vladimir Nabokov play of humorous courtesy, to choose between a rocker and the divan (their bed after ten p.m.). I say “familiar” because one day she had welcomed me with the same wrist dance to her party in Beardsley. We both sat down on the divan. Curious: although actually her looks had faded, I definitelyrealized,sohopelesslylateintheday,howmuch she looked — had always looked — like Botticelli’s russet Venus — the same soft nose, the same blurred beauty. In my pocket my fingersgentlyletgoandrepackeda little at the tip, within the handkerchief it was nested in, my unused weapon. “that’s not the fellow I want,” I said. Thediffuselookofwelcomelefthereyes.Herforeheadpuckeredasintheoldbitter days: “Not who?” “Where is he? Quick!” “Look,” she said, inclining her head to one side and shaking it in that position. “Look, you are not going to bring that up.” “I certainly am,” I said, and for a moment — strangely enough the only merciful, endurable one in the whole interview — we were bristling at each other as if she were still mine. A wise girl, she controlled herself. Dick did not know a thing of the whole mess. He thought I was her father. He thought she had run away from an upper-class home just to wash dishes in a diner. He believed anything. Why should I want to make things harder than they were by raking up all that muck? But, I said, she must be sensible, she must be a sensible girl (with her bare drum under that thin brown stuff),shemustunderstandthatifsheexpectedthehelpIhadcome to give, I must have at least a clear comprehension of the situation. “Come, his name!” She thought I had guessed long ago. It was (with a mischievous and melancholy smile) such a sensational name. I would never believe it. She could hardly believe it herself. His name, my fall nymph. It was so unimportant, she said. She suggested I skip it. Would I like a cigarette? No. His name. She shook her head with great resolution. She guessed it was too late to raise hell and I would never believe the unbelievably unbelievable — I said I had better go, regards, nice to have seen her. She said really it was useless, she would never tell, but on the other hand, after all — “Do you really want to know who it was? Well, it was —” And softly, confidentially,archingherthineyebrowsandpuckeringherparchedlips, she emitted, a little mockingly, somewhat fastidiously, not untenderly, in a kind of muted whistle, the name that the astute reader has guessed long ago. Waterproof. Why did a flashfromHourglassLakecrossmyconsciousness?I,too,had known it, without knowing it, all along. Therewasnoshock,nosurprise.Quietly Vladimir Nabokov — Lolita 181 the fusion took place, and everything fell into order, into the pattern of branches that I have woven throughout this memoir with the express purpose of having the ripe fruit fall at the right moment; yes, with the express and perverse purpose of rendering — she was talking but I sat melting in my golden peace — of rendering that golden and monstrous peace through the satisfaction of logical recognition, which my most inimical reader should experience now. She was, as I say, talking. It now came in a relaxed flow.Hewastheonlymanshe had ever been crazy about. What about Dick? Oh, Dick was a lamb, they were quite happy together, but she meant something different.AndI had never counted, of course? She considered me as if grasping all at once the incredible — and somehow tedious, confusing and unnecessary — fact that the distant, elegant, slender, forty-year-old valetudinarian in velvet coat sitting beside her had known and adored every pore and follicle of her pubescent body. In her washed-out gray eyes, strangely spectacled, our poor romance was for a moment reflected,ponderedupon,anddismissedlikeadullparty, like a rainy picnic to which only the dullest bores had come, like a humdrum exercise, like a bit of dry mud caking her childhood. I just managed to jerk my knee out of the range of a sketchy tap — one of her acquired gestures. She asked me not to be dense. Thepastwasthepast.Ihadbeenagoodfather,sheguessed — granting me that. Proceed, Dolly Schiller. Well, did I know that he had known her mother? Thathewaspracticallyanoldfriend? ThathehadvisitedwithhisuncleinRamsdale?—oh,yearsago—andspoken at Mother’s club, and had tugged and pulled her, Dolly, by her bare arm onto his lap in front of everybody, and kissed her face, she was ten and furious with him? Did I know he had seen me and her at the inn where he was writing the very play she was to rehearse in Beardsley, two years later? Did I know — It had been horrid of her to sidetrack me into believing that Clare was an old female, maybe a relative of his or a sometime lifemate — and oh, what a close shave it had been when the Wace Journal carried his picture. TheBriceland Gazette had not. Yes, very amusing. Yes, she said, this world was just one gag after another, if somebody wrote up her life nobody would ever believe it. At this point, there came brisk homey sounds from the kitchen into which Dick and Bill had lumbered in quest of beer. Throughthedoorwaytheynoticedthevisitor,and Dick entered the parlor. “Dick, this is my Dad!” cried Dolly in a resounding violent voice that struck me as a totally strange, and new, and cheerful, and old, and sad, because the young fellow, veteran of a remote war, was hard of hearing. Arctic blue eyes, black hair, ruddy cheeks, unshaven chin. We shook hands. Discreet Bill, who evidently took pride in working wonders with one hand, brought in the beer cans he had opened. Wanted to withdraw. Theexquisitecourtesyofsim182 Lolita — Vladimir Nabokov ple folks. Was made to stay. A beer ad. In point of fact, I preferred it that way, and so did the Schillers. I switched to the jittery rocker. Avidly munching, Dilly plied me with marshmallows and potato chips. Themenlookedatherfragile,frileux, diminutive, old-world, youngish but sickly, father in velvet coat and beige vest, maybe a viscount. TheywereundertheimpressionIhadcometostay,andDickwithagreatwrinkling of brows that denoted difficultthought,suggestedDollyandhemightsleepinthe kitchen on a spare mattress. I waved a light hand and told Dolly who transmitted it by means of a special shout to Dick that I had merely dropped in on my way to Readsburg where I was to be entertained by some friends and admirers. It was then noticed that one of the few thumbs remaining to Bill was bleeding (not such a wonder-worker after all). How womanish and somehow never seen that way before was the shadowy division between her pale breasts when she bent down over the man’s hand! She took him for repairs to the kitchen. For a few minutes, three or four little eternities which positively welled with artificialwarmth,DickandIremainedalone.He sat on a hard chair rubbing his forelimbs and frowning. I had an idle urge to squeeze out the blackheads on the wings of his perspiring nose with my long agate claws. He had nice sad eyes with beautiful lashes, and very white teeth. His Adam’s apple was large and hairy. Why don’t they shave better, those young brawny chaps? He and his Dolly had had unrestrained intercourse on that couch there, at least a hundred and eighty times, probably much more; and before that — how long had she known him? No grudge. Funny — no grudge at all, nothing except grief and nausea. He was now rubbing his nose. I was sure that when finallyhewouldopenhismouth,hewouldsay (slightly shaking his head): “Aw, she’s a swell kid, Mr. Haze. She sure is. And she’s going to make a swell mother.” He opened his mouth — and took a sip of beer. Thisgave him countenance — and he went on sipping till he frothed at the mouth. He was a lamb. He had cupped her Florentine breasts. His fingernailswereblackandbroken, but the phalanges, the whole carpus, the strong shapely wrist were far, far finerthan mine: I have hurt too much too many bodies with my twisted poor hands to be proud of them. French epithets, a Dorset yokel’s knuckles, an Austrian tailor’s flatfinger tips — that’s Humbert Humbert. Good. If he was silent I could be silent too. Indeed, I could very well do with a little rest in this subdued, frightened-to-death rocking chair, before I drove to wherever the beast’s lair was — and then pulled the pistol’s foreskin back, and then enjoyed the orgasm of the crushed trigger: I was always a good little follower of the Viennese medicine man. But presently I became sorry for poor Dick whom, in some hypnotoid way, I was horribly preventing from making the only remark he could think up (“She’s a swell kid…”). “And so,” I said, “you are going to Canada?” In the kitchen, Dolly was laughing at something Bill had said or done. “And so,” I shouted, “you are going to Canada? Not Canada” — I re-shouted — “I mean Alaska, of course.” Vladimir Nabokov — Lolita 183 He nursed his glass and, nodding sagely, replied: “Well, he cut it on a jagger, I guess. Lost his right arm in Italy.” Lovely mauve almond trees in bloom. A blown-offsurrealisticarmhangingupthere in the pointillistic mauve. A flowergirltattooonthehand.Dollyandband-aidedBill reappeared. It occurred to me that her ambiguous, brown and pale beauty excited the cripple. Dick, with a grin of relief stood up. He guessed Bill and he would be going back to fixthosewires.HeguessedMr.HazeandDollyhadloadsofthingstosayto each other. He guessed he would be seeing me before I left. Why do those people guess so much and shave so little, and are so disdainful of hearing aids? “Sit down,” she said, audibly striking her flankswithherpalms.Irelapsedintothe black rocker. “So you betrayed me? Where did you go? Where is he now?” She took from the mantelpiece a concave glossy snapshot. Old woman in white, stout, beaming, bowlegged, very short dress; old man in his shirtsleeves, drooping mustache, watch chain. Her in-laws. Living with Dick’s brother’s family in Juneau. “Sure you don’t want to smoke?” She was smoking herself. First time I saw her doing it. Streng verboten under Humbert the Terrible. Gracefully, in a blue mist, Charlotte Haze rose from her grave. I would findhimthroughUncleIvoryifsherefused. “Betrayed you? No.” She directed the dart of her cigarette, index rapidly tapping upon it, toward the hearth exactly as her mother used to do, and then, like her mother, oh my God, with her fingernailscratchedandremovedafragmentofcigarettepaperfrom her underlip. No. She had not betrayed me. I was among friends. Edusa had warned her that Cue liked little girls, had been almost jailed once, in fact (nice fact), and he knew she knew. Yes… Elbow in palm, puff,smile,exhaledsmoke,dartinggesture. Waxing reminiscent. He saw — smiling — through everything and everybody, because he was not like me and her but a genius. A great guy. Full of fun. Had rocked with laughter when she confessed about me and her, and said he had thought so. It was quite safe, under the circumstances, to tell him… Well, Cue — they all called him Cue — Her camp fiveyearsago.Curiouscoincidence—…tookhertoaduderanchabouta day’s drive from Elephant (Elphinstone). Named? Oh, some silly name — Duk Duk Ranch — you know just plain silly — but it did not matter now, anyway, because the place had vanished and disintegrated. Really, she meant, I could not imagine how utterly lush that ranch was, she meant it had everything but everything, even an indoor waterfall. Did I remember the red-haired guy we (“we” was good) had once had some tennis with? Well, the place really belonged to Red’s brother, but he had turned it over to Cue for the summer. When Cue and she came, the others had them actually go through a coronation ceremony and then — a terrificducking,aswhenyoucross the Equator. You know. Her eyes rolled in synthetic resignation. “Go on, please.” 184 Lolita — Vladimir Nabokov Well. TheideawashewouldtakeherinSeptembertoHollywoodandarrangea tryout for her, a bit part in the tennis-match scene of a movie picture based on a play of his — Golden Guts — and perhaps even have her double one of its sensational starlets on the Klieg-struck tennis court. Alas, it never came to that. “Where is the hog now?” He was not a hog. He was a great guy in many respects. But it was all drink and drugs. And, of course, he was a complete freak in sex matters, and his friends were his slaves. I just could not imagine (I, Humbert, could not imagine!) what they all did at Duk Duk Ranch. She refused to take part because she loved him, and he threw her out. “What things?” “Oh, weird, filthy,fancythings.Imean,hehadtwogirlsandtowboys,andthreeor four men, and the idea was for all of us to tangle in the nude while an old woman took movie pictures.” (Sade’s Justine was twelve at the start.) “What things exactly?” “Oh, things… Oh, I — really I” — she uttered the “I” as a subdued cry while she listened to the source of the ache, and for lack of words spread the fivefingersofherangularly up-and-down-moving hand. No, she gave it up, she refused to go into particulars with that baby inside her. Thatmadesense. “It is of no importance now,” she said pounding a gray cushion with her fistandthen lying back, belly up, on the divan. “Crazy things, filthythings.Isaidno,I’mjustnot going to [she used, in all insouciance really, a disgusting slang term which, in a literal French translation, would be souffler] your beastly boys, because I want only you. Well, he kicked me out.” Therewasnotmuchelsetotell.Thatwinter?949,Fayandshehadfoundjobs.Foralmost two years she had — oh, just drifted, oh, doing some restaurant work in small places, and then she had met Dick. No, she did not know where the other was. In New York, she guessed. Of course, he was so famous she would have found him at once if she had wanted. Fay had tried to get back to the Ranch — and it just was not there any more — it had burned to the ground, nothing remained, just a charred heap of rubbish. It was so strange, so strange — She closed her eyes and opened her mouth, leaning back on the cushion, one felted foot on the floor.Thewoodenfloorslanted,alittlesteelballwouldhaverolledinto the kitchen. I knew all I wanted to know. I had no intention of torturing my darling. Somewhere beyond Bill’s shack an afterwork radio had begun singing of folly and fate, and there she was with her ruined looks and her adult, rope-veined narrow hands and her goose-fleshwhitearms,andhershallowears,andherunkemptarmpits,there she was (my Lolita!), hopelessly worn at seventeen, with that baby, dreaming already in her of becoming a big shot and retiring around 2020 A.D. — and I looked and looked at her, and knew as clearly as I know I am to die, that I loved her more than anything I had ever seen or imagined on earth, or hoped for anywhere else. She Vladimir Nabokov — Lolita 185 was only the faint violet whiffanddeadleafechoofthenymphetIhadrolledmyselfupon with such cries in the past; an echo on the brink of a russet ravine, with a far wood under a white sky, and brown leaves choking the brook, and one last cricket in the crisp weeds… but thank God it was not that echo alone that I worshipped. What I used to pamper among the tangled vines of my heart, mon grand pêché radieux, had dwindled to its essence: sterile and selfishvice,allthatIcanceledandcursed.Youmayjeer at me, and threaten to clear the court, but until I am gagged and half-throttled, I will shout my poor truth. I insist the world know how much I loved my Lolita, this Lolita, pale and polluted, and big with another’s child, but still gray-eyed, still sooty-lashed, still auburn and almond, still Carmencita, still mine; Changeons de vie, ma Carmen, allons vivre quelque part où nous ne serons jamais séparés; Ohio? ThewildsofMassachusetts? No matter, even if those eyes of hers would fade to myopic fish,andher nipples swell and crack, and her lovely young velvety delicate delta be tainted and torn — even then I would go mad with tenderness at the mere sight of your dear wan face, at the mere sound of your raucous young voice, my Lolita. “Lolita,” I said, “this may be neither here nor there but I have to say it. Life is very short. From here to that old car you know so well thee is a stretch of twenty, twenty-fivepaces.Itisaveryshortwalk.Makethosetwenty-fivesteps.Now.Rightnow.Come just as you are. And we shall live happily ever after.” Carmen, voulez-vous venir avec moi? “You mean,” she said opening her eyes and raising herself slightly, the snake that may strike, “you mean you will give us [us] that money only if I go with you to a motel. Is that what you mean?” “No,” I said, “you got it all wrong. I want you to leave your incidental Dick, and this awful hole, and come to live with me, and die with me, and everything with me” (words to that effect). “You’re crazy,” she said, her features working. “Thinkitover,Lolita.Therearenostringsattached.Except,perhaps— well,nomatter.” (A reprieve, I wanted to say but did not.) “Anyway, if you refuse you will still get your… trousseau.” “No kidding?” asked Dolly. I handed her an envelope with four hundred dollars in cash and a check for three thousand six hundred more. Gingerly, uncertainly, she received mon petit cadeau; and then her forehead became a beautiful pink. “You mean,” she said, with agonized emphasis, “you are giving us four thousand bucks?” I covered my face with my hand and broke into the hottest tears I had ever shed. I felt them winding through my fingersanddownmychin,andburningme,and my nose got clogged, and I could not stop, and then she touched my wrist. “I’ll die if you touch me,” I said. “You are sure you are not coming with me? Is there no hope of your coming? Tell me only this.” “No,” she said. “No, honey, no.” She had never called me honey before. 186 Lolita — Vladimir Nabokov “No,” she said, “it is quite out of the question. I would sooner go back to Cue. I mean —” She groped for words. I supplied them mentally (“He broke my heart. You merely broke my life”). “I think,” she went on — “oops” — the envelope skidded to the floor—shepickedit up — “I think it’s oh utterly grand of you to give us all that dough. It settles everything, we can start next week. Stop crying, please. You should understand. Let me get you some more beer. Oh, don’t cry, I’m so sorry I cheated so much, but that’s the way things are.” I wiped my face and my fingers.Shesmiledatthecadeau. She exulted. She wanted to call Dick. I said I would have to leave in a moment, did not want to see him at all, at all. We tried to think of some subject of conversation. For some reason, I kept seeing — it trembled and silkily glowed on my damn retina — a radiant child of twelve, sitting on a threshold, “pinging” pebbles at an empty can. I almost said — trying to findsome casual remark — “I wonder sometimes what has become of the little McCoo girl, did she ever get better?” — but stopped in time lest she rejoin: “I wonder sometimes what has become of the little Haze girl…” Finally, I reverted to money matters. Thatsum, I said, represented more or less the net rent from her mother’s house; she said: “Had it not been sold years ago?” No (I admit I had told her this in order to sever all connections with R.); a lawyer would send a full account of the financialsituationlater;it was rosy; some of the small securities her mother had owned had gone up and up. Yes, I was quite sure I had to go. I had to go, and findhim,anddestroyhim. Since I would not have survived the touch of her lips, I kept retreating in a mincing dance, at every step she and her belly made toward me. She and the dog saw me off.Iwassurprised(thisarhetoricalfigure,I wasnot)thatthe sight of the old car in which she had ridden as a child and a nymphet, left her so very indifferent.Allsheremarkedwasitwasgettingsortofpurplishaboutthegills.I said it was hers, I could go by bus. She said don’t be silly, they would flytoJupiterand buy a car there. I said I would buy this one from her for fivehundreddollars. “At this rate we’ll be millionnaires next,” she said to the ecstatic dog. Carmencita, lui demandais-je… “One last word,” I said in my horrible careful English, “are you quite, quite sure that — well, not tomorrow, of course, and not after tomorrow, but — well — some day, any day, you will not come to live with me? I will create a brand new God and thank him with piercing cries, if you give me that microscopic hope” (to that effect). “No,” she said smiling, “no.” “It would have made all the difference,”saidHumbertHumbert. ThenIpulledoutmyautomatic—Imean,thisisthekindoffoolthingareadermight suppose I did. It never even occurred to me to do it. “Good by-aye!” she chanted, my American sweet immortal dead love; for she is dead and immortal if you are reading this. I mean, such is the formal agreement with the so-called authorities. Vladimir Nabokov — Lolita 187 Then,asIdroveaway,IheardhershoutinavibrantvoicetoherDick;andthedogstarted to lope alongside my car like a fat dolphin, but he was too heavy and old, and very soon gave up. And presently I was driving through the drizzle of the dying day, with the windshield wipers in full action but unable to cope with my tears. 30 Leaving as I did Coalmont around four in the afternoon (by Route X — I do not remember the number(, I might have made Ramsdale by dawn had not a short-cut tempted me. I had to get onto Highway Y. My map showed quite blandly that just beyond Woodbine, which I reached at nightfall, I could leave paved X and reached paved Y by means of a transverse dirt road. It was only some forty miles long according to my map. Otherwise I would have to follow X for another hundred miles and then use leisurely looping Z to get to Y and my destination. However, the short-cut in question got worse and worse, bumpier and bumpier, muddier and muddier, and when I attempted to turn back after some ten miles of purblind, tortuous and tortoise-slow progress, my old and weak Melmoth got stuck in deep clay. All was dark and muggy, and hopeless. My headlights hung over a broad ditch full of water. Thesurrounding country, if any, was a black wilderness. I sought to extricate myself but my rear wheels only whined in slosh and anguish. Cursing my plight, I took offmyfancyclothes, changed into slacks, pulled on the bullet-riddled sweater, and waded four miles back to a roadside farm. It started to rain on the way but I had not the strength to go back for a mackintosh. Such incidents have convinced me that my heart is basically sound despite recent diagnoses. Around midnight, a wrecker dragged my car out. I navigated back to Highway X and traveled on. Utter weariness overtook me and hour later, in an anonymous little town. I pulled up at the curb and in darkness drank deep from a friendly flask. Therainhadbeencanceledmilesbefore.Itwasablackwarmnight,somewhereinAppalachia. Now and then cars passed me, red tail-lights receding, white headlights advancing, but the town was dead. Nobody strolled and laughed on the sidewalks as relaxing burghers would in sweet, mellow, rotting Europe. I was alone to enjoy the innocent night and my terrible thoughts. A wire receptacle on the curb was very particular about acceptable contents: Sweepings. Paper. No Garbage. Sherry-red letters of light marked a Camera Shop. A large thermometer with the name of a laxative quietly dwelt on the front of a drugstore. Rubinov’s Jewelry company had a display of artificialdiamondsreflectedina redmirror.A lightedgreenclockswaminthelinenishdepths of JiffyJeffLaundry.Ontheothersideofthestreeta garagesaidinitssleep-genuflectionlubricity;andcorrecteditselftoGulflexLubrication.Anairplane,alsogemmed by Rubinov, passed, droning, in the velvet heavens. How many small dead-of-night towns I had seen! Thiswasnotyetthelast. 188 Lolita — Vladimir Nabokov Let me dally a little, he is as good as destroyed. Some way further across the street, neon lights flickeredtwiceslowerthanmyheart:theoutlineofarestaurantsign,a large coffee-pot,keptbursting,everyfullsecondorso,intoemeraldlife,andeverytime it went out, pink letters saying Fine Foods relayed it, but the pot could still be made out as a latent shadow teasing the eye before its next emerald resurrection. We made shadow-graphs. ThisfurtiveburgwasnotfarfromTheEnchantedHunters.I was weeping again, drunk on the impossible past. 31 At this solitary stop for refreshments between Coalmont and Ramsdale (between innocent Dolly Schiller and jovial Uncle Ivor), I reviewed my case. With the utmost simplicity and clarity I now saw myself and my love. Previous attempts seemed out of focus in comparison. A couple of years before, under the guidance of an intelligent French-speaking confessor, to whom, in a moment of metaphysical curiosity, I had turned over a Protestant’s drab atheism for an old-fashioned popish cure, I had hoped to deduce from my sense of sin the existence of a Supreme Being. On those frosty mornings in rime-laced Quebec, the good priest worked on me with the finesttenderness and understanding. I am infinitelyobligedtohimandthegreatInstitutionhe represented. Alas, I was unable to transcend the simple human fact that whatever spiritual solace I might find,whateverlithophaniceternitiesmightbeprovidedforme, nothing could make my Lolita forget the foul lust I had inflicteduponher.Unless it can be proven to me — to me as I am now, today, with my heart and by beard, and my putrefaction — that in the infiniterunitdoesnotmatterajotthataNorthAmerican girl-child named Dolores Haze had been deprived of her childhood by a maniac, unless this can be proven (and if it can, then life is a joke), I see nothing for the treatment of my misery but the melancholy and very local palliative of articulate art. To quote an old poet: Themoralsenseinmortalsistheduty We have to pay on mortal sense of beauty. 32 Therewastheday,duringourfirsttrip— ourfirstcircleof paradise—whenin orderto enjoy my phantasms in peace I firmlydecidedtoignorewhatIcouldnothelpperceiving, the fact that I was to her not a boy friend, not a glamour man, not a pal, not even a person at all, but just two eyes and a foot of engorged brawn — to mention only mentionable matters. Therewasthedaywhenhavingwithdrawnthefunctionalpromise I had made her on the eve (whatever she had set her funny little heart on — a roller Vladimir Nabokov — Lolita 189 rink with some special plastic floororamoviematineetowhichshewantedtogoalone), I happened to glimpse from the bathroom, through a chance combination of mirror aslant and door ajar, a look on her face… that look I cannot exactly describe… an expression of helplessness so perfect that it seemed to grade into one of rather comfortable inanity just because this was the very limit of injustice and frustration — and every limit presupposes something beyond it — hence the neutral illumination. And when you bear in mind that these were the raised eyebrows and parted lips of a child, you may better appreciate what depths of calculated carnality, what reflecteddespair,restrained me from falling at her dear feet and dissolving in human tears, and sacrificingmyjealousytowhateverpleasureLolitamighthopetoderivefrommixingwithdirty and dangerous children in an outside world that was real to her. And I have still other smothered memories, now unfolding themselves into limbless monsters of pain. Once, in a sunset-ending street of Beardsley, she turned to little Eva Rosen (I was taking both nymphets to a concert and walking behind them so close as almost to touch them with my person), she turned to Eva, and so very serenely and seriously, in answer to something the other had said about its being better to die than hear Milton Pinski, some local schoolboy she knew, talk about music, my Lolita remarked: “You know, what’s so dreadful about dying is that you are completely on your own”; and it struck me, as my automaton knees went up and down, that I simply did not know a thing about my darling’s mind and that quite possibly, behind the awful juvenile clichés, there was in her a garden and a twilight, and a palace gate — dim and adorable regions which happened to be lucidly and absolutely forbidden to me, in my polluted rags and miserable convulsions; for I often noticed that living as we did, she and I, in a world of total evil, we would become strangely embarrassed whenever I tried to discuss something she and an older friend, she and a parent, she and a real healthy sweetheart, I and Annabel, Lolita and a sublime, purified,analyzed,deifiedHarold Haze, might have discussed — an abstract idea, a painting, stippled Hopkins or shorn Baudelaire, God or Shakespeare, anything of genuine kind. Good will! She would mail her vulnerability in trite brashness and boredom, whereas I, using for my desperately detached comments an artificialtoneofvoicethatsetmyownlastteethon edge, provoked my audience to such outbursts of rudeness as made any further conversation impossible, oh my poor, bruised child. I loved you. I was a pentapod monster, but I loved you. I was despicable and brutal, and turpid, and everything, mais je t’aimais, je t’aimais! And there were times when I knew how you felt, and it was hell to know it, my little one. Lolita girl, brave Dolly Schiller. I recall certain moments, let us call them icebergs in paradise, when after having had my fillofher—afterfabulous,insaneexertionsthatleftmelimpandazure-barred — I would gather her in my arms with, at last, a mute moan of human tenderness (her skin glistening in the neon light coming from the paved court through the slits in the blind, her soot-black lashes matted, her grave gray eyes more vacant than ev190 Lolita — Vladimir Nabokov er — for all the world a little patient still in the confusion of a drug after a major operation) — and the tenderness would deepen to shame and despair, and I would lull and rock my lone light Lolita in my marble arms, and moan in her warm hair, and caress her at random and mutely ask her blessing, and at the peak of this human agonized selflesstenderness(withmysoulactuallyhangingaroundhernakedbodyand ready to repent), all at once, ironically, horribly, lust would swell again — and “oh, no,” Lolita would say with a sigh to heaven, and the next moment the tenderness and the azure — all would be shattered. Mid-twentieth century ideas concerning child-parent relationship have been considerably tainted by the scholastic rigmarole and standardized symbols of the psychoanalytic racket, but I hope I am addressing myself to unbiased readers. Once when Avis’s father had honked outside to signal papa had come to take his pet home, I felt obliged to invite him into the parlor, and he sat down for a minute, and while we conversed, Avis, a heavy, unattractive, affectionatechild,drewuptohimandeventually perched plumply on his knee. Now, I do not remember if I have mentioned that Lolita always had an absolutely enchanting smile for strangers, a tender furry slitting of the eyes, a dreamy sweet radiance of all her features which did not mean a thing of course, but was so beautiful, so endearing that one found it hard to reduce such sweetness to but a magic gene automatically lighting up her face in atavistic token of some ancient rite of welcome — hospitable prostitution, the coarse reader may say. Well, there she stood while Mr. Byrd twirled his hat and talked, and — yes, look how stupid of me, I have left out the main characteristic of the famous Lolita smile, namely: while the tender, nectared, dimpled brightness played, it was never directed at the stranger in the room but hung in its own remote floweredvoid,sotospeak,orwanderedwithmyopic softness over chance objects — and this is what was happening now: while fat Avis sidled up to her papa, Lolita gently beamed at a fruit knife that she fingeredonthe edge of the table, whereon she leaned, many miles away from me. Suddenly, as Avis clung to her father’s neck and ear while, with a casual arm, the man enveloped his lumpy and large offspring,IsawLolita’ssmileloseallitslightandbecomeafrozen little shadow of itself, and the fruit knife slipped offthetableandstruckherwithits silver handle a freak blow on the ankle which made her gasp, and crouch head forward, and then, jumping on one leg, her face awful with the preparatory grimace which children hold till the tears gush, she was gone — to be followed at once and consoled in the kitchen by Avis who had such a wonderful fat pink dad and a small chubby brother, and a brand-new baby sister, and a home, and two grinning dogs, and Lolita had nothing. And I have a neat pendant to that little scene — also in a Beardsley setting. Lolita, who had been reading near the fire,stretchedherself,andtheninquired, her elbow up, with a grunt: “Where is she buried anyway?” “Who?” “Oh, you know, my murdered mummy.” “And you know where her grave is,” I said controlling myself, whereupon I named the cemetery — just outside Ramsdale, between the railway tracks and Lakeview Hill. “Moreover,” I added, “the tragedy of such an accident is somewhat cheapened by the epithet you saw fittoapplytoit.Ifyoureallywishto Vladimir Nabokov — Lolita 191 triumph in your mind over the idea of death —” “Ray,” said Lo for hurrah, and languidly left the room, and for a long while I stared with smarting eyes into the fire.ThenIpickedupherbook.Itwassometrashforyoungpeople.Therewasa gloomygirl Marion, and there was her stepmother who turned out to be, against all expectations, a young, gay, understanding redhead who explained to Marion that Marion’s dead mother had really been a heroic woman since she had deliberately dissimulated her great love for Marion because she was dying, and did not want her child to miss her. I did not rush up to her room with cries. I always preferred the mental hygiene of noninterference. Now, squirming and pleading with my own memory, I recall that on this and similar occasions, it was always my habit and method to ignore Lolita’s states of mind while comforting my own base self. When my mother, in a livid wet dress, under the tumbling mist (so I vividly imagined her), had run panting ecstatically up that ridge above Moulinet to be felled there by a thunderbolt, I was but an infant, and in retrospect no yearnings of the accepted kind could I ever graft upon any moment of my youth, no matter how savagely psychotherapists heckled me in my later periods of depression. But I admit that a man of my power of imagination cannot plead personal ignorance of universal emotions. I may also have relied too much on the abnormally chill relations between Charlotte and her daughter. But the awful point of the whole argument is this. It had become gradually clear to my conventional Lolita during our singular and bestial cohabitation that even the most miserable of family lives was better than the parody of incest, which, in the long run, was the best I could offerthewaif. 33 Ramsdale revisited. I approached it from the side of the lake. Thesunnynoonwasalleyes. As I rode by in my mud-fleckedcar,Icoulddistinguishscintillasofdiamondwater between the far pines. I turned into the cemetery and walked among the long and short stone monuments. Bonzhur, Charlotte. On some of the graves there were pale, transparent little national flagsslumpedinthewindlessairundertheevergreens.Gee,Ed, that was bad luck — referring to G. Edward Grammar, a thirty-five-year-oldNewYork officemanagerwhohadjustbeenarrayedona chargeofmurderinghisthirty-three-year-old wife, Dorothy. Bidding for the perfect crime, Ed had bludgeoned his wife and put her into a car. Thecasecametolightwhentwocountypolicemenonpatrol saw Mrs. Grammar’s new big blue Chrysler, an anniversary present from her husband, speeding crazily down a hill, just inside their jurisdiction (God bless our good cops!). Thecarsideswipedapole,ranupanembankmentcoveredwithbeardgrass,wild strawberry and cinquefoil, and overturned. Thewheelswerestillgentlyspinningin the mellow sunlight when the officersremovedMrs.G’sbody.Itappearedtoberoutine highway accident at first.Alas,thewoman’sbatteredbodydidnotmatchupwith only minor damage sufferedbythecar.Ididbetter. 192 Lolita — Vladimir Nabokov I rolled on. It was funny to see again the slender white church and the enormous elms. Forgetting that in an American suburban street a lone pedestrian is more conspicuous than a lone motorist, I left the car in the avenue to walk unobtrusively past 342 Lawn Street. Before the great bloodshed, I was entitled to a little relief, to a cathartic spasm of mental regurgitation. Closed were the white shutters of the Junk mansion, and somebody had attached a found black velvet hair ribbon to the white FOR SALE sign which was leaning toward the sidewalk. No dog barked. No gardener telephoned. No Miss Opposite sat on the vined porch — where to the lone pedestrian’s annoyance two pony-tailed young women in identical polka-dotted pinafores stopped doing whatever they were doing to stare at him: she was long dead, no doubt, these might be her twin nieces from Philadelphia. Should I enter my old house? As in a Turgenev story, a torrent of Italian music came from an open window — that of the living room: what romantic soul was playing the piano where no piano had plunged and plashed on that bewitched Sunday with the sun on her beloved legs? All at once I noticed that from the lawn I had mown a golden-skinned, brown-haired nymphet of nine or ten, in white shorts, was looking at me with wild fascination in her large blue-black eyes. I said something pleasant to her, meaning no harm, an old-world compliment, what nice eyes you have, but she retreated in haste and the music stopped abruptly, and a violent-looking dark man, glistening with sweat, came out and glared at me. I was on the point of identifying myself when, with a pang of dream-embarrassment, I became aware of my mud-caked dungarees, my filthyandtornsweater,mybristlychin,mybum’sbloodshoteyes.Withoutsaying a word, I turned and plodded back the way I had come. An aster-like anemic flowergrewoutofarememberedchinkinthesidewalk.Quietlyresurrected,MissOpposite was being wheeled out by her nieces, onto her porch, as if it were a stage and I the star performer. Praying she would not call to me, I hurried to my car. What a steep little street. What a profound avenue. A red ticket showed between wiper and windshield; I carefully tore it into two, four, eight pieces. Feeling I was losing my time, I drove energetically to the downtown hotel where I had arrived with a new bag more than fiveyearsbefore.Itookaroom,madetwoappointments by telephone, shaved, bathed, put on black clothes and went down for a drink in the bar. Nothing had changed. Thebarroomwassuffusedwiththesamedim, impossible garnet-red light that in Europe years ago went with low haunts, but here meant a bit of atmosphere in a family hotel. I sat at the same little table where at the very start of my stay, immediately after becoming Charlotte’s lodger, I had thought fittocelebratetheoccasionbysuavelysharingwithherhalfabottleofchampagne,which had fatally conquered her poor brimming heart. As then, a moon-faced waiter was arranging with stellar care fiftysherriesonaroundtrayforaweddingparty.Murphy-Fantasia, this time. It was eight minutes to three. As I walked though the lobby, I had to skirt a group of ladies who with mille grâces were taking leave of each other after a luncheon party. With a harsh cry of recognition, one pounced upon me. She was a stout, short woman in pearl-gray, with a long, gray, slim plume to her small hat. Vladimir Nabokov — Lolita 193 It was Mrs. Chatfield.Sheattackedmewithafakesmile,allaglowwithevilcuriosity. (Had I done to Dolly, perhaps, what Frank Lasalle, a fifty-year-oldmechanic,haddone o eleven-year-old Sally Horner in ?948?) Very soon I had that avid glee well under control She thought I was in California. How was —? With exquisite pleasure I informed her that my stepdaughter had just married a brilliant young mining engineer with a hush-hush job in the Northwest. She said she disapproved of such early marriages, she would never let her Phyllis, who was now eighteen — “Oh yes, of course,” I said quietly. “I remember Phyllis. Phyllis and Camp Q. yes, of course. By the way, did she ever tell you how Charlie Holmes debauched there his mother’s little charges?” Mrs. Chatfiled’salreadybrokensmilenowdisintegratedcompletely. “For shame,” she cried, “for shame, Mr. Humbert! Thepoorboyhasjustbeenkilledin Korea.” I said didn’t she think “vient de,” with the infinitive,expressedrecenteventssomuch more neatly than the English “just,” with the past? But I had to be trotting off,I said. TherewereonlytwoblockstoWindmuller’soffice.He greetedme withaveryslow,very enveloping, strong, searching grip. He thought I was in California. Had I not lived at one time at Beardsley? His daughter had just entered Beardsley College. And how was —? I have all necessary information about Mrs. Schiller. We had a pleasant business conference. I walked out into the hot September sunshine a contented pauper. Now that everything had been put out of the way, I could dedicate myself freely to the main object of my visit to Ramsdale. In the methodical manner on which I have always prided myself, I had been keeping Clare Quilty’s face masked in my dark dungeon, where he was waiting for me to come with barber and priest: “Réveillez-vous, Laqueue, il est temps de mourir!” I have no time right now to discuss the mnemonics of physiognomization — I am on my way to his uncle and walking fast — but let me jot down this: I had preserved in the alcohol of a clouded memory the toad of a face. In the course of a few glimpses, I had noticed its slight resemblance to a cheery and rather repulsive wine dealer, a relative of mine in Switzerland. With his dumbbells and stinking tricot, and fat hairy arms, and bald patch, and pig-faced servant-concubine, he was on the whole a harmless old rascal. Too harmless, in fact, to be confused with my prey. In the state of mind I now found myself, I had lost contact with Trapp’s image. It had become completely engulfed by the face of Clare Quilty — as represented, with artistic precision, by an easeled photograph of him that stood on his uncle’s desk. In Beardsley, at the hands of charming Dr. Molnar, I had undergone a rather serious dental operation, retaining only a few upper and lower front teeth. Thesubstitutes were dependent on a system of plates with an inconspicuous wire affairrunningalong my upper gums. Thewholearrangementwasamasterpieceofcomfort,andmycanines were in perfect health. However, to garnish my secret purpose with a plausible pretext, I told Dr. Quilty that, in hope of alleviating facial neuralgia, I had decided to have all my teeth removed. What would a complete set of dentures cost? How long 194 Lolita — Vladimir Nabokov would the process take, assuming we fixedourfirstappointmentforsometimeinNovember? Where was his famous nephew now? Would it be possible to have them all out in one dramatic session? A white-smocked, gray-haired man, with a crew cut and the big flatcheeksofa politician, Dr. Quilty perched on the corner of his desk, one foot dreamily and seductively rocking as he launched on a glorious long-range plan. He would firstprovideme with provisional plates until the gums settled. Thenhewouldmakemeapermanent set. He would like to have a look at that mouth of mine. He wore perforated pied shoes. He had not visited with the rascal since ?946, but supposed he could be found at his ancestral home, Grimm Road, not far from Parkington. It was a noble dream. His foot rocked, his gaze was inspired. It would cost me around six hundred. He suggested he take measurements right away, and make the firstsetbeforestarting operations. My mouth was to him a splendid cave full of priceless treasures, but I denied him entrance. “No,” I said. “On second thoughts, I shall have it all done by Dr. Molnar. His price is higher, but he is of course a much better dentist than you.” I do not know if any of my readers will ever have a chance to say that. It is a delicious dream feeling. Clare’s uncle remained sitting on the desk, still looking dreamy, but his foot had stopped push-rocking the cradle of rosy anticipation. On the other hand, his nurse, a skeleton-thin, faded girl, with the tragic eyes of unsuccessful blondes, rushed after me so as to be able to slam the door in my wake. Push the magazine into the butt. Press home until you hear or feel the magazine catch engage. Delightfully snug. Capacity: eight cartridges. Full Blued. Aching to be discharged. 34 A gas station attendant in Parkington explained to me very clearly how to get to Grimm Road. Wishing to be sure Quilty would be at home, I attempted to ring him up but learned that his private telephone had recently been disconnected. Did that mean he was gone? I started to drive to Grimm Road, twelve miles north of the town. By that time night had eliminated most of the landscape and as I followed the narrow winding highway, a series of short posts, ghostly white, with reflectors,borrowedmyown lights to indicate this or that curve. I could make out a dark valley on one side of the road and wooded slopes on the other, and in front of me, like derelict snowflakes,moths drifted out of the blackness into my probing aura. At the twelfth mile, as foretold, a curiously hooded bridge sheathed me for a moment and, beyond it, a white-washed rock loomed on the right, and a few car lengths further, on the same side, I turned offthehighwayupgravellyGrimmRoad.Foracoupleofminutesallwasdank, dark, dense forest. Then,PavorManor,awoodenhousewithaturret,aroseina circular clearing. Its windows glowed yellow and red; its drive was cluttered with half Vladimir Nabokov — Lolita 195 a dozen cars. I stopped in the shelter of the trees and abolished my lights to ponder the next move quietly. He would be surrounded by his henchmen and whores. I could not help seeing the inside of that festive and ramshackle castle in terms of “Troubled Teens,” a story in one of her magazines, vague “orgies,” a sinister adult with penele cigar, drugs, bodyguards. At least, he was there. I would return in the torpid morning. Gently I rolled back to town, in that old faithful car of mine which was serenely, almost cheerfully working for me. My Lolita! Therewasstillathree-year-oldbobbypin of hers in the depths of the glove compartment. Therewasstillthatstreamofpalemoths siphoned out of the night by my headlights. Dark barns still propped themselves up here and there by the roadside. People were still going to the movies. While searching for night lodgings, I passed a drive-in. In a selenian glow, truly mystical in its contrast with the moonless and massive night, on a gigantic screen slanting away among dark drowsy fields,athinphantomraisedagun,bothheandhisarmreducedto tremulous dishwater by the oblique angle of that receding world, — and the next moment a row of trees shut offthegesticulation. 35 I left Insomnia Lodge next morning around eight and spent some time in Parkington. Visions of bungling the execution kept obsessing me. Thinkingthatperhapsthecartridges in the automatic had gone stale during a week of inactivity, I removed them and inserted a fresh batch. Such a thorough oil bath did I give Chum that now I could not get rid of the stuff.Ibandagedhimupwitharag,likeamaimedlimb,andusedanother rag to wrap up a handful of spare bullets. A thunderstorm accompanied me most of the way back to Grimm Road, but when I reached Pavor Manor, the sun was visible again, burning like a man, and the birds screamed in the drenched and steaming trees. Theelaborateanddecrepithouse seemed to stand in a kind of daze, reflectingasitweremyownstate,forIcouldnot help realizing, as my feet touched the springy and insecure ground, that I had overdone the alcoholic stimulation business. A guardedly ironic silence answered my bell. Thegarage,however,wasloadedwith his car, a black convertible for the nonce. I tried the knocker. Re-nobody. With a petulant snarl, I pushed the front door — and, how nice, it swung open as in a medieval fairy tale. Having softly closed it behind me, I made my way across a spacious and very ugly hall; peered into an adjacent drawing room; noticed a number of used glasses growing out of the carpet; decided that master was still asleep in the master bedroom. So I trudged upstairs. My right hand clutched muffledChuminmypocket,myleft patted the sticky banisters. Of the three bedrooms I inspected, one had obviously been slept in that night. Therewasalibraryfullofflowers.Therewasaratherbareroom with ample and deep mirrors and a polar bear skin on the slippery floor.There 196 Lolita — Vladimir Nabokov were still other rooms. A happy though struck me. If and when master returned from his constitutional in the woods, or emerged from some secret lair, it might be wise for an unsteady gunman with a long job before him to prevent his playmate from locking himself up in a room. Consequently, for at least fiveminutesIwentabout—lucidlyinsane, crazily calm, an enchanted and very tight hunter — turning whatever keys in whatever locks there were and pocketing more planned privacy than have modern glamour-boxes, where the bathroom, the only lockable locus, has to be used for the furtive needs of planned parenthood. Speaking of bathrooms — I was about to visit a third one when master came out of it, leaving a brief waterfall behind him. Thecornerofapassagedidnotquiteconceal me. Gray-faced, baggy-eyed, fluffilydisheveledin ascantybaldingway,butstillperfectly recognizable, he swept by me in a purple bathrobe, very like one I had. He either did not notice me, or else dismissed me as some familiar and innocuous hallucination — and, showing me his hairy calves, he proceeded, sleepwalker-wise, downstairs. I pocketed my last key and followed him into the entrance hall. He had half opened his mouth and the front door, to peer out through a sunny chink as one who thinks he has heard a half-hearted visitor ring and recede. Then,stillignoringtheraincoated phantasm that had stopped in midstairs, master walked into a cozy boudoir across the hall from the drawing room, through which — taking it easy, knowing he was safe — I now went away from him, and in a bar-adorned kitchen gingerly unwrapped dirty Chum, talking care not to leave any oil stains on the chrome — I think I got the wrong product, it was black and awfully messy. In my usual meticulous way, I transferred naked Chum to a clean recess about me and made for the little boudoir. My step, as I say, was springy — too springy perhaps for success. But my heart pounded with tiger joy, and I crunched a cocktail glass underfoot. Master met me in the Oriental parlor. “Now who are you?” he asked in a high hoarse voice, his hands thrust into his dressing-gown pockets, his eyes fixingapointtothenortheastofmyhead.“Areyouby any chance Brewster?” By now it was evident to everybody that he was in a fog and completely at my so-called mercy. I could enjoy myself. “That’sright,”Iansweredsuavely.“Je suis Monsieur Brustère. Let us chat for a moment before we start.” He looked pleased. His smudgy mustache twitched. I removed my raincoat. I was wearing a black suit, a black shirt, no tie. We sat down in two easy chairs. “You know,” he said, scratching loudly his fleshyandgrittygraycheekandshowing his small pearly teeth in a crooked grin, “you don’t look like Jack Brewster. I mean, the resemblance is not particularly striking. Somebody told me he had a brother with the same telephone company.” To have him trapped, after those years of repentance and rage… To look at the black hairs on the back of his pudgy hands… To wander with a hundred eyes over his purVladimir Nabokov — Lolita 197 ple silks and hirsute chest foreglimpsing the punctures, and mess, and music of pain… To know that this semi-animated, subhuman trickster who had sodomized my darling — oh, my darling, this was intolerable bliss! “No, I am afraid I am neither of the Brewsters.” “He cocked his head, looking more pleased than ever. “Guess again, Punch.” “Ah,” said Punch, “so you have not come to bother me about those long-distance calls?” “You do make them once in a while, don’t you?” “Excuse me?” I said I had said I thought he had said he had never — “People,” he said, “people in general, I’m not accusing you, Brewster, but you know it’s absurd the way people invade this damned house without even knocking. Theyusethe vaterre, they use the kitchen, they use the telephone. Phil calls Philadelphia. Pat calls Patagonia. I refuse to pay. You have a funny accent, Captain.” “Quilty,” I said, “do you recall a little girl called Dolores Haze, Dolly Haze? Dolly called Dolores, Colo.?” “Sure, she may have made those calls, sure. Any place. Paradise, Wash., Hell Canyon. Who cares?” “I do, Quilty. You see, I am her father.” “Nonsense,” he said. “You are not. You are some foreign literary agent. A Frenchman once translated my Proud Flesh as La Fierté de la Chair. Absurd.” “She was my child, Quilty.” In the state he was in he could not really be taken aback by anything, but his blustering manner was not quite convincing. A sort of wary inkling kindled his eyes into a semblance of life. Theywereimmediatelydulledagain. “I’m very fond of children myself,” he said, “and fathers are among my best friends.” He turned his head away, looking for something. He beat his pockets. He attempted to rise from his seat. “Down!” I said — apparently much louder than I intended. “You need not roar at me,” he complained in his strange feminine manner. “I just wanted a smoke. I’m dying for a smoke.” “You’re dying anyway.” “Oh, chucks,” he said. “You begin to bore me. What do you want? Are you French, mister? Wooly-woo-boo-are? Let’s go to the barroomette and have a stiff—” He saw the little dark weapon lying in my palm as if I were offeringittohim. “Say!” he drawled (now imitating the underworld numskull of movies), “that’s a swell little gun you’ve got there. What d’you want for her?” I slapped down his outstretched hand and he managed to knock over a box on a low table near him. It ejected a handful of cigarettes. 198 Lolita — Vladimir Nabokov “Here they are,” he said cheerfully. “You recall Kipling: une femme est une femme, mais un Caporal est une cigarette? Now we need matches.” “Quilty,” I said. “I want you to concentrate. You are going to die in a moment. Thehereafterforallweknowmaybeaneternalstateofexcruciatinginsanity.Yousmoked your last cigarette yesterday. Concentrate. Try to understand what is happening to you.” He kept taking the Drome cigarette apart and munching bits of it. “I am willing to try,” he said. “You are either Australian, or a German refugee. Must you talk to me? ThisisaGentile’shouse,youknow.Maybe,you’dbetterrunalong.Anddo stop demonstrating that gun. I’ve an old Stern-Luger in the music room.” I pointed Chum at his slippered foot and crushed the trigger. It clicked. He looked at his foot, at the pistol, again at his foot. I made another awful effort,and,witharidiculously feeble and juvenile sound, it went off.Thebulletenteredthethickpinkrug,and I had the paralyzing impression that it had merely trickled in and might come out again. “See what I mean?” said Quilty. “You should be a little more careful. Give me that thing for Christ’s sake.” He reached for it. I pushed him back into the chair. Therichjoywaswaning.Itwas high time I destroyed him, but he must understand why he was being destroyed. His condition infected me, the weapon felt limp and clumsy in my hand. “Concentrate,” I said, “on the thought of Dolly Haze whom you kidnapped —” “I did not!” he cried. “You’re all wet. I saved her from a beastly pervert. Show me your badge instead of shooting at my foot, you ape, you. Where is that badge? I’m not responsible for the rapes of others. Absurd! Thatjoyride,Igrantyou,wasasillystuntbut you got her back, didn’t you? Come, let’s have a drink.” I asked him whether he wanted to be executed sitting or standing. “Ah, let me think,” he said. “It is not an easy question. Incidentally — I made a mistake. Which I sincerely regret. You see, I had no fun with your Dolly. I am practically impotent, to tell the melancholy truth. And I gave her a splendid vacation. She met some remarkable people. Do you happen to know —” And with a tremendous lurch he fell all over me, sending the pistol hurtling under a chest of drawers. Fortunately he was more impetuous than vigorous, and I had little difficultyinshovinghimbackintohischair. He puffedalittleandfoldedhisarmsonhischest. “Now you’ve done it,” he said. “Vous voilà dans de beaux draps, mon vieux.” His French was improving. I looked around. Perhaps, if — Perhaps I could — On my hands and knees? Risk it? “Alors, que fait-on?” he asked watching me closely. I stooped. He did not moved. I stooped lower. “My dear sir,” he said, “stop triflingwithlifeanddeath.Iamaplaywright.Ihavewritten tragedies, comedies, fantasies. I have made private movies out of Justine and Vladimir Nabokov — Lolita 199 other eighteenth-century sexcapades. I’m the author of fifty-twosuccessfulscenarios.I know all the ropes. Let me handle this. Thereshouldbeapokersomewhere,whydon’t I fetch it, and then we’ll fishoutyourproperty.” Fussily, busybodily, cunningly, he had risen again while he talked. I groped under the chest trying at the same time to keep an eye on him. All of a sudden I noticed that he had noticed that I did not seem to have noticed Chum protruding from beneath the other corner of the chest. We fell to wrestling again. We rolled all over the floor,in each other’s arms, like two huge helpless children. He was naked and goatish under his robe, and I felt suffocatedasherolledoverme.Irolledoverhim.Werolledoverme. Theyrolledoverhim.Werolledoverus. In its published form, this book is being read, I assume, in the firstyearsof2000A.D. (?935 plus eighty or ninety, live long, my love); and elderly readers will surely recall at this point the obligatory scene in the Westerns of their childhood. Our tussle, however, lacked the ox-stunning fisticuffs,theflyingfurniture.He andIweretwolarge dummies, stuffedwithdirtycottonandrags.Itwasasilent,soft,formlesstussle on the part of two literati, one of whom was utterly disorganized by a drug while the other was handicapped by a heart condition and too much gin. When at last I had possessed myself of my precious weapon, and the scenario writer had been reinstalled in his low chair, both of us were panting as the cowman and the sheepman never do after their battle. I decided to inspect the pistol — our sweat might have spoiled something — and regain my wind before proceeding to the main item in the program. To fillinthepause,I proposed he read his own sentence — in the poetical form I had given it. Theterm“poetical justice” is one that may be most happily used in this respect. I handed him a neat typescript. “Yes,” he said, “splendid idea. Let me fetch my reading glasses” (he attempted to rise). “No.” “Just as you say. Shall I read out loud?” “Yes.” “Here goes. I see it’s in verse. Because you took advantage of a sinner because you took advantage because you took because you took advantage of my disadvantage… “That’sgood,youknow.That’sdamnedgood.” …when I stood Adam-naked before a federal law and all its stinging stars 200 Lolita — Vladimir Nabokov “Oh, grand stuff!” …Because you took advantage of a sin when I was helpless moulting moist and tender hoping for the best dreaming of marriage in a mountain state aye of a litter of Lolitas… “Didn’t get that.” Because you took advantage of my inner essential innocence because you cheated me — “A little repetitious, what? Where was I?” Because you cheated me of my redemption because you took her at the age when lads play with erector sets “Getting smutty, eh?” a little downy girl still wearing poppies still eating popcorn in the colored gloam where tawny Indians took paid croppers because you stole her from her wax-browed and dignifiedprotector spitting into his heavy-lidded eye ripping his flavidtogaandatdawn leaving the hog to roll upon his new discomfort the awfulness of love and violets remorse despair while you took a dull doll to pieces and threw its head away because of all you did because of all I did not you have to die “Well, sir, this is certainly a finepoem.YourbestasfarasI’mconcerned.” He folded and handed it back to me. Vladimir Nabokov — Lolita 201 I asked him if he had anything serious to say before dying. Theautomaticwasagain ready for use on the person. He looked at it and heaved a big sigh. “Now look here, Mac,” he said. “You are drunk and I am a sick man. Let us postpone the matter. I need quiet. I have to nurse my impotence. Friends are coming in the afternoon to take me to a game. Thispistol-packingfaceisbecomingafrightfulnuisance. We are men of the world, in everything — sex, free verse, marksmanship. If you bear me a grudge, I am ready to make unusual amends. Even an old-fashioned rencontre, sword or pistol, in Rio or elsewhere — is not excluded. My memory and my eloquence are not at their best today, but really, my dear Mr. Humbert, you were not an ideal stepfather, and I did not force your little protégée to join me. It was she made me remove her to a happier home. Thishouseisnotasmodernasthatranchweshared with dear friends. But it is roomy, cool in summer and winter, and in a word comfortable, so, since I intend retiring to England or Florence forever, I suggest you move in. It is yours, gratis. Under the condition you stop pointing at me that [he swore disgustingly] gun. By the way, I do not know if you care for the bizarre, but if you do, I can offeryou,alsogratis,ashousepet,aratherexcitinglittlefreak,ayoungladywiththree breasts, one a dandy, this is a rare and delightful marvel of nature. Now, soyons raisonnables. You will only wound me hideously and then rot in jail while I recuperate in a tropical setting. I promise you, Brewster, you will be happy here, with a magnificentcellar,andalltheroyaltiesfrommynextplay—Ihavenotmuchatthebankright now but I propose to borrow — you know, as the Bard said, with that cold in his head, to borrow and to borrow and to borrow. Thereareotheradvantages.Wehavehere a most reliable and bribable charwoman, a Mrs. Vibrissa — curious name — who comes from the village twice a week, alas not today, she has daughters, granddaughters, a thing or two I know about the chief of police makes him my slave. I am a playwright. I have been called the American Maeterlinck. Maeterlinck-Schmetterling, says I. Come on! All this is very humiliating, and I am not sure I am doing the right thing. Never use herculanita with rum. Now drop that pistol like a good fellow. I knew your dear wife slightly. You may use my wardrobe. Oh, another thing — you are going to like this. I have an absolutely unique collection of erotica upstairs. Just to mention one item: the in folio de-luxe Bagration Island by the explorer and psychoanalyst Melanie Weiss, a remarkable lady, a remarkable work — drop that gun — with photographs of eight hundred and something male organs she examined and measured in ?932 on Bagration, in the Barda Sea, very illuminating graphs, plotted with love under pleasant skies — drop that gun — and moreover I can arrange for you to attend executions, not everybody knows that the chair is painted yellow —” Feu. ThistimeIhitsomethinghard.Ihitthebackofablackrockingchair,notunlike Dolly Schiller’s — my bullet hit the inside surface of its back whereupon it immediately went into a rocking act, so fast and with such zest that any one coming into the room might have been flabbergastedbythedoublemiracle:thatchairrockingina panic all by itself, and the armchair, where my purple target had just been, now void of all life content. Wiggling his fingersintheair,witharapidheaveofhisrump,he 202 Lolita — Vladimir Nabokov flashedintothemusicroomandthenextsecondweweretuggingandgaspingonbothsides of the door which had a key I had overlooked. I won again, and with another abrupt movement Clare the Impredictable sat down before the piano and played several atrociously vigorous, fundamentally hysterical, plangent chords, his jowls quivering, his spread hands tensely plunging, and his nostrils emitting the soundtrack snorts which had been absent from our fight.Stillsingingthoseimpossiblesonorities,hemade a futile attempt to open with his foot a kind of seaman’s chest near the piano. My next bullet caught him somewhere in the side, and he rose from his chair higher and higher, like old, gray, mad Nijinski, like Old faithful, like some old nightmare of mine, to a phenomenal altitude, or so it seemed, as he rent the air — still shaking with the rich black music — head thrown back in a howl, hand pressed to his brow, and with his other hand clutching his armpit as if stung by a hornet, down he came on his heels and, again a normal robed man, scurried out into the hall. I see myself following him through the hall, with a kind of double, triple, kangaroo jump, remaining quite straight on straight legs while bouncing up twice in his wake, and then bouncing between him and the front door in a ballet-like stiffbounce,withthe purpose of heading him off,sincethedoorwasnotproperlyclosed. Suddenly dignified,andsomewhatmorose,hestartedtowalkupthebroadstairs,and, shifting my position, but not actually following him up the steps, I firedthreeorfour times in quick succession, wounding him at every blaze; and every time I did it to him, that horrible thing to him, his face would twitch in an absurd clownish manner, as if he were exaggerating the pain; he slowed down, rolled his eyes half closing them and made a feminine “ah!” and he shivered every time a bullet hit him as if I were tickling him, and every time I got him with those slow, clumsy, blind bullets of mine, he would say under his breath, with a phony British accent — all the while dreadfully twitching, shivering, smirking, but withal talking in a curiously detached and even amiable manner: “Ah, that hurts, sir, enough! Ah, that hurts atrociously, my dear fellow. I pray you, desist. Ah — very painful, very painful, indeed… God! Hah! Thisisabominable, you should really not —” His voice trailed offashereachedthelanding,but he steadily walked on despite all the lead I had lodged in his bloated body — and in distress, in dismay, I understood that far from killing him I was injecting spurts of energy into the poor fellow, as if the bullets had been capsules wherein a heady elixir danced. I reloaded the thing with hands that were black and bloody — I had touched something he had anointed with his thick gore. ThenIrejoinedhimupstairs,thekeysjangling in my pockets like gold. He was trudging from room to room, bleeding majestically, trying to findanopenwindow, shaking his head, and still trying to talk me out of murder. I took aim at his head, and he retired to the master bedroom with a burst of royal purple where his ear had been. “Get out, get out of here,” he said coughing and spitting; and in a nightmare of wonder, I saw this blood-spattered but still buoyant person get into his bed and wrap Vladimir Nabokov — Lolita 203 himself up in the chaotic bedclothes. I hit him at very close range through the blankets, and then he lay back, and a big pink bubble with juvenile connotations formed on his lips, grew to the size of a toy balloon, and vanished. I may have lost contact with reality for a second or two — oh, nothing of the I-just-blacked-out sort that your common criminal enacts; on the contrary, I want to stress the fact that I was responsible for every shed drop of his bubbleblood; but a kind of momentary shift occurred as if I were in the connubial bedroom, and Charlotte were sick in bed. Quilty was a very sick man. I held one of his slippers instead of the pistol — I was sitting on the pistol. ThenImademyselfalittlemorecomfortablein the chair near the bed, and consulted my wrist watch. Thecrystalwasgonebutitticked. Thewholesadbusinesshadtakenmorethananhour.Hewasquietatlast.Farfrom feeling any relief, a burden even weightier than the one I had hoped to get rid of was with me, upon me, over me. I could not bring myself to touch him in order to make sure he was really dead. He looked it: a quarter of his face gone, and two fliesbeside themselves with a dawning sense of unbelievable luck. My hands were hardly in better condition than his. I washed up as best I could in the adjacent bathroom. Now I could leave. As I emerged on the landing, I was amazed to discover that a vivacious buzz I had just been dismissing as a mere singing in my ears was really a medley of voices and radio music coming from the downstairs drawing room. I found there a number of people who apparently had just arrived and were cheerfully drinking Quilty’s liquor. Therewasafatmaninaneasychair;andtwodark-haired pale young beauties, sisters no doubt, big one and small one (almost a child), demurely sat side by side on a davenport. A florid-facedfellowwithsapphire-blueeyeswas in the act of bringing two glasses out of the bar-like kitchen, where two or three women were chatting and chinking ice. I stopped in the doorway and said: “I have just killed Clare Quilty.” “Good for you,” said the floridfellowasheofferedoneofthe drinks to the elder girl. “Somebody ought to have done it long ago,” remarked the fat man. “What does he say, Tony?” asked a faded blonde from the bar. “He says,” answered the floridfellow,“hehaskilledCue.”“Well,”saidanotherunidentifiedmanrising in a corner where he had been crouching to inspect some records, “I guess we all should do it to him some day.” “Anyway,” said Tony, “he’d better come down. We can’t wait for him much longer if we want to go to that game.” “Give this man a drink somebody,” said the fat person. “What a beer?” said a woman in slacks, showing it to me from afar. Only the two girls on the davenport, both wearing black, the younger fingeringa bright something about her white neck, only they said nothing, but just smiled on, so young, so lewd. As the music paused for a moment, there was a sudden noise on the stairs. Tony and I stepped out into the hall. Quilty of all people had managed to crawl out onto the landing, and there we could see him, flappingandheaving,andthen subsiding, forever this time, in a purple heap. “Hurry up, Cue,” said Tony with a laugh. “I believe, he’s still —” He returned to the drawing room, music drowned the rest of the sentence. 204 Lolita — Vladimir Nabokov This,Isaidtomyself,wastheendoftheingeniousplaystagedformebyQuilty.With a heavy heart I left the house and walked though the spotted blaze of the sun to my car. Two other cars were parked on both sides of it, and I had some trouble squeezing out. 36 Therestisalittleflattishandfaded.SlowlyI drovedownhill,andpresentlyfoundmyself going at the same lazy pace in a direction opposite to Parkington. I had left my raincoat in the boudoir and Chum in the bathroom. No, it was not a house I would have liked to live in. I wondered idly if some surgeon of genius might not alter his own career, and perhaps the whole destiny of mankind, by reviving quilted Quilty, Clare Obscure. Not that I cared; on the whole I wished to forget the whole mess — and when I did learn he was dead, the only satisfaction it gave me, was the relief of knowing I need not mentally accompany for months a painful and disgusting convalescence interrupted by all kinds of unmentionable operations and relapses, and perhaps an actual visit from him, with trouble on my part to rationalize him as not being a ghost. Thomashadsomething.Itisstrangethatthetactilesense,whichissoinfinitelylessprecioustomenthansight,becomesatcriticalmomentourmain,ifnot only, handle to reality. I was all covered with Quilty — with the feel of that tumble before the bleeding. Theroadnowstretchedacrossopencountry,anditoccurredtome—notbywayofprotest, not as a symbol, or anything like that, but merely as a novel experience — that since I had disregarded all laws of humanity, I might as well disregard the rules of traffic.SoIcrossedtotheleftsideofthehighwayandcheckedthefeeling,andthefeelingwas good. It was a pleasant diaphragmal melting, with elements of diffusedtactility,allthis enhanced by the thought that nothing could be nearer to the elimination of basic physical laws than deliberately driving on the wrong side of the road. In a way, it was a very spiritual itch. Gently, dreamily, not exceeding twenty miles an hour, I drove on that queer mirror side. Trafficwaslight.CarsthatnowandthenpassedmeonthesideI had abandoned to them, honked at me brutally. Cars coming towards me wobbled, swerved, and cried out in fear. Presently I found myself approaching populated places. Passing through a red light was like a sip of forbidden Burgundy when I was a child. Meanwhile complications were arising. I was being followed and escorted. Theninfront of me I saw two cars placing themselves in such a manner as to completely block my way. With a graceful movement I turned offtheroad,andaftertwoorthreebigbounces, rode up a grassy slope, among surprised cows, and there I came to a gentle rocking stop. A kind of thoughtful Hegelian synthesis linking up two dead women. I was soon to be taken out of the car (Hi, Melmoth, thanks a lot, old fellow) — and was, indeed, looking forward to surrender myself to many hands, without doing anything to cooperate, while they moved and carried me, relaxed, comfortable, surrenVladimir Nabokov — Lolita 205 dering myself lazily, like a patient, and deriving an eerie enjoyment from my limpness and the absolutely reliable support given me by the police and the ambulance people. And while I was waiting for them to run up to me on the high slope, I evoked a last mirage of wonder and hopelessness. One day, soon after her disappearance, an attack of abominable nausea forced me to pull up on the ghost of an old mountain road that now accompanied, now traversed a brand new highway, with its population of asters bathing in the detached warmth of a pale-blue afternoon in late summer. After coughing myself inside out, I rested a while on a boulder, and then, thinking the sweet air might do me good, walked a little way toward a low stone parapet on the precipice side of the highway. Small grasshoppers spurted out of the withered roadside weeds. A very light cloud was opening its arms and moving toward a slightly more substantial one belonging to another, more sluggish, heavenlogged system. As I approached the friendly abyss, I grew aware of a melodious unity of sounds rising like vapor from a small mining town that lay at my feet, in a fold of the valley. One could make out the geometry of the streets between blocks of red and gray roofs, and green puffsoftrees,andaserpentinestream,andtherich,ore-likeglitterofthecitydump,and beyond the town, roads crisscrossing the crazy quilt of dark and pale fields,andbehind it all, great timbered mountains. But even brighter than those quietly rejoicing colors — for there are colors and shades that seem to enjoy themselves in good company — both brighter and dreamier to the ear than they were to the eye, was that vapory vibration of accumulated sounds that never ceased for a moment, as it rose to the lip of granite where I stood wiping my foul mouth. And soon I realized that all these sounds were of one nature, that no other sounds but these came from the streets of the transparent town, with the women at home and the men away. Reader! What I heard was but the melody of children at play, nothing but that, and so limpid was the air that within this vapor of blended voices, majestic and minute, remote and magically near, frank and divinely enigmatic — one could hear now and then, as if released, an almost articulate spurt of vivid laughter, or the crack of a bat, or the clatter of a toy wagon, but it was all really too far for the eye to distinguish any movement in the lightly etched streets. I stood listening to that musical vibration from my lofty slope, to those flashesofseparatecrieswithakindofdemuremurmurforbackground,and then I knew that the hopelessly poignant thing was not Lolita’s absence from my side, but the absence of her voice from that concord. Thisthenismystory.Ihaverereadit.Ithasbitsofmarrowstickingtoit,andblood,and beautiful bright-green flies.AtthisorthattwistofitIfeelmyslipperyselfeluding me, gliding into deeper and darker waters than I care to probe. I have camouflagedwhat I could so as not to hurt people. And I have toyed with many pseudonyms for myself before I hit on a particularly apt one. Thereareinmynotes“OttoOtto”and“Mesmer Mesmer” and “Lambert Lambert,” but for some reason I think my choice expresses the nastiness best. When I started, fifty-sixdaysago,towriteLolita, firstinthepsychopathicwardforobservation, and then in this well-heated, albeit tombal, seclusion, I thought I would 206 Lolita — Vladimir Nabokov use these notes in toto at my trial, to save not my head, of course, but my soul. In mind-composition, however, I realized that I could not parade living Lolita. I still may use parts of this memoir in hermetic sessions, but publication is to be deferred. For reasons that may appear more obvious than they really are, I am opposed to capital punishment; this attitude will be, I trust, shared by the sentencing judge. Had I come before myself, I would have given Humbert at least thirty-fiveyearsforrape,and dismissed the rest of the charges. But even so, Dolly Schiller will probably survive me by many years. ThefollowingdecisionImakewithallthelegalimpactandsupport of a signed testament: I wish this memoir to be published only when Lolita is no longer alive. Thus,neitherofusisalivewhenthereaderopensthisbook.Butwhilethebloodstill throbs through my writing hand, you are still as much part of blessed matter as I am, and I can still talk to you from here to Alaska. Be true to your Dick. Do not let other fellows touch you. Do not talk to strangers. I hope you will love your baby. I hope it will be a boy. Thathusbandofyours,Ihope,willalwaystreatyouwell,because otherwise my specter shall come at him, like black smoke, like a demented giant, and pull him apart nerve by nerve. And do not pity C.Q. One had to choose between him and H.H., and one wanted H.H. to exist at least a couple of months longer, so as to have him make you live in the minds of later generations. I am thinking of aurochs and angels, the secret of durable pigments, prophetic sonnets, the refuge of art. And this is the only immortality you and I may share, my Lolita. Vladimir Nabokov — Lolita 207 Vladimir Nabokov On a book entitled Lolita After doing my impersonation of suave John Ray, the character in Lolita who pens the Foreword, any comments coming straight from me may strike one — may strike me, in fact — as an impersonation of Vladimir Nabokov talking about his own book. A few points, however, have to be discussed; and the autobiographic device may induce mimic and model to blend. Teachers of Literature are apt to think up such problems as “What is the author’s purpose?” or still worse “What is the guy trying to say?” Now, I happen to be the kind of author who in starting to work on a book has no other purpose than to get rid of that book and who, when asked to explain its origin and growth, has to rely on such ancient terms as Interreaction of Inspiration and Combination — which, I admit, sounds like a conjurer explaining one trick by performing another. ThefirstlittlethrobofLolita went through me late in ?939 or early in ?940, in Paris, at a time when I was laid up with a severe attack of intercostal neuralgia. As far as I can recall, the initial shiver of inspiration was somehow prompted by a newspaper story about an ape in the Jardin des Plantes, who, after months of coaxing by a scientist, produced the firstdrawingevercharcoaledbyananimal:thissketchshowedthebarsofthe poor creature’s cage. TheimpulseIrecordhadnotextualconnectionwiththeensuing train of thought, which resulted, however, in a prototype of my present novel, a short story some thirty pages long. I wrote it in Russian, the language in which I had been writing novels since ?924 (the best of these are not translated into English, and all are prohibited for political reasons in Russia). ThemanwasaCentralEuropean,theanonymous nymphet was French, and the loci were Paris and Provence. I had him marry the little girl’s sick mother who soon died, and after a thwarted attempt to take advantage of the orphan in a hotel room, Arthur (for that was his name) threw himself under the wheels of a truck. I read the story one blue-papered wartime night to a group of friends — Mark Aldanov, two social revolutionaries, and a woman doctor; but I was not pleased with the thing and destroyed it sometime after moving to America in ?940. 208 Lolita — Vladimir Nabokov Around ?949, in Ithaca, upstate New York, the throbbing, which had never quite ceased, began to plague me again. Combination joined inspiration with fresh zest and involved me in a new treatment of the theme, this time in English — the language of my firstgovernessinSt.Petersburg,circa?903,aMissRachelHome.Thenymphet,now with a dash of Irish blood, was really much the same lass, and the basic marrying-her-mother idea also subsisted; but otherwise the thing was new and had grown in secret the claws and wings of a novel. Thebookdevelopedslowly,withmanyinterruptionsandasides.Ithadtakenme some forty years to invent Russia and Western Europe, and now I was faced by the task of inventing America. Theobtainingofsuchlocalingredientsaswouldallowme to inject a modicum of average “reality” (one of the few words which mean nothing without quotes) into the brew of individual fancy, proved at fiftyamuchmoredifficultprocessthanithadbeenintheEuropeofmyyouthwhenreceptivenessandretention were at their automatic best. Other books intervened. Once or twice I was on the point of burning the unfinisheddraftandhadcarriedmyJuanitaDarkasfaras the shadow of the leaning incinerator on the innocent lawn, when I was stopped by the thought that the ghost of the destroyed book would haunt my filesfortherestof my life. Every summer my wife and I go butterflyhunting.Thespecimensaredepositedat scientificinstitutions,suchastheMuseumofComparativeZoologyatHarvardorthe Cornell University collection. Thelocalitylabelspinnedunderthesebutterflieswillbe a boon to some twenty-first-centuryscholarwithatasteforreconditebiography.It was at such of our headquarters as Telluride, Colorado; Afton, Wyoming; Portal, Arizona; and Ashland, Oregon, that Lolita was energetically resumed in the evenings or on cloudy days. I finishedcopyingthethingoutinlonghandinthespringof?954,and at once began casting around for a publisher. At first,ontheadviceofawaryoldfriend,Iwasmeekenoughtostipulatethatthe book be brought out anonymously. I doubt that I shall ever regret that soon afterwards, realizing how likely a mask was to betray my own cause, I decided to sign Lolita. ThefourAmericanpublishers,W,X,Y,Z,whointurnwereofferedthetypescript and had their readers glance at it, were shocked by Lolita to a degree that even my wary old friend F.P. had not expected. While it is true that in ancient Europe, and well into the eighteenth century (obvious examples come from France), deliberate lewdness was not inconsistent with flashesofcomedy,orvigoroussatire,oreventheverveofafinepoetina wantonmood, it is also true that in modern times the term “pornography” connotes mediocrity, commercialism, and certain strict rules of narration. Obscenity must be mated with banality because every kind of aesthetic enjoyment has to be entirely replaced by simple sexual stimulation which demands the traditional word for direct action upon the patient. Old rigid rules must be followed by the pornographer in order to have his patient feel the same security of satisfaction as, for example, fans of detective stories feel — stories where, if you do not watch out, the real murderer may turn out Vladimir Nabokov — Lolita 209 to be, to the fan’s disgust, artistic originality (who for instance would want a detective story without a single dialogue in it?). Thus,inpornographicnovels,actionhasto be limited to the copulation of clichés. Style, structure, imagery should never distract the reader from his tepid lust. Thenovelmustconsistofanalternationofsexualscenes. Thepassagesinbetweenmustbereducedtosuturesofsense,logicalbridgesof the simplest design, brief expositions and explanations, which the reader will probably skip but must know they exist in order not to feel cheated (a mentality stemming from the routine of “true” fairy tales in childhood). Moreover, the sexual scenes in the book must follow a crescendo line, with new variations, new combinations, new sexes, and a steady increase in the number of participants (in a Sade play they call the gardener in), and therefore the end of the book must be more replete with lewd lore than the firstchapters. Certain techniques in the beginning of Lolita (Humbert’s Journal, for example) misled some of my firstreadersintoassumingthatthiswasgoingtobealewdbook.Theyexpectedtherisingsuccessionoferoticscenes;whenthesestopped,thereadersstopped, too, and felt bored and let down. This,Isuspect,isoneofthereasonswhynotall the four firmsreadthetypescripttotheend.Whethertheyfounditpornographicor not did not interest me. Theirrefusaltobuythebookwasbasednotonmytreatment of the theme but on the theme itself, for there are at least three themes which are utterly taboo as far as most American publishers are concerned. Thetwoothersare: a Negro-White marriage which is a complete and glorious success resulting in lots of children and grandchildren; and the total atheist who lives a happy and useful life, and dies in his sleep at the age of ?06. Some of the reactions were very amusing: one reader suggested that his firmmightconsider publication if I turned my Lolita into a twelve-year-old lad and had him seduced by Humbert, a farmer, in a barn, amidst gaunt and arid surroundings, all this set forth in short, strong, “realistic” sentences (“He acts crazy. We all act crazy, I guess. I guess God acts crazy.” Etc.). Although everybody should know that I detest symbols and allegories (which is due partly to my old feud with Freudian voodooism and partly to my loathing of generalizations devised by literary mythists and sociologists), an otherwise intelligent reader who flippedthroughthefirstpartdescribedLolita as “Old Europe debauching young America,” while another flippersawinit“YoungAmericadebauching old Europe.” Publisher X, whose advisers got so bored with Humbert that they never got beyond page ?88, had the naïveté to write me that Part Two was too long. Publisher Y, on the other hand, regretted there were no good people in the book. Publisher Z said if he printed Lolita, he and I would go to jail. No writer in a free country should be expected to bother about the exact demarcation between the sensuous and the sensual; this is preposterous; I can only admire but cannot emulate the accuracy of judgment of those who pose the fair young mammals photographed in magazines where the general neckline is just low enough to provoke a past master’s chuckle and just high enough not to make a postmaster frown. I presume there exist readers who findtitillatingthedisplayofmuralwords 210 Lolita — Vladimir Nabokov in those hopelessly banal and enormous novels which are typed out by the thumbs of tense mediocrities and called “powerful” and “stark” by the reviewing hack. Thereare gentle souls who would pronounce Lolita meaningless because it does not teach them anything. I am neither a reader nor a writer of didactic fiction,and,despiteJohnRay’s assertion, Lolita has no moral in tow. For me a work of fictionexistsonlyinsofar as it affordsmewhatIshallbluntlycallaestheticbliss,thatisasenseofbeingsomehow, somewhere, connected with other states of being where art (curiosity, tenderness, kindness, ecstasy) is the norm. Therearenotmanysuchbooks.Alltherestis either topical trash or what some call the Literature of Ideas, which very often is topical trash corning in huge blocks of plaster that are carefully transmitted from age to age until somebody comes along with a hammer and takes a good crack at Balzac, at Gorki, at Mann. Another charge which some readers have made is that Lolita is anti-American. Thisissomethingthatpainsmeconsiderablymorethantheidioticaccusationofimmorality. Considerations of depth and perspective (a suburban lawn, a mountain meadow) led me to build a number of North American sets. I needed a certain exhilarating milieu. Nothing is more exhilarating than philistine vulgarity. But in regard to philistine vulgarity there is no intrinsic differencebetweenPalearcticmannersandNearctic manners. Any proletarian from Chicago can be as bourgeois (in the Flaubertian sense) as a duke. I chose American motels instead of Swiss hotels or English inns only because I am trying to be an American writer and claim only the same rights that other American writers enjoy. On the other hand, my creature Humbert is a foreigner and an anarchist, and there are many things, besides nymphets, in which I disagree with him. And all my Russian readers know that my old worlds — Russian, British, German, French — are just as fantastic and personal as my new one is. Lest the little statement I am making here seem an airing of grudges, I must hasten to add that besides the lambs who read the typescript of Lolita or its Olympia Press edition in a spirit of “Why did he have to write it?” or “Why should I read about maniacs?” there have been a number of wise, sensitive, and staunch people who understood my book much better than I can explain its mechanism here. Every serious writer, I dare say, is aware of this or that published book of his as of a constant comforting presence. Its pilot light is steadily burning somewhere in the basement and a mere touch applied to one’s private thermostat instantly results in a quiet little explosion of familiar warmth. Thispresence,thisglowofthebookinan ever accessible remoteness is a most companionable feeling, and the better the book has conformed to its prefiguredcontourandcolortheamplerandsmootheritglows.But even so, there are certain points, byroads, favorite hollows that one evokes more eagerly and enjoys more tenderly than the rest of one’s book. I have not reread Lolita since I went through the proofs in the spring of ?955 but I findittobeadelightful presence now that it quietly hangs about the house like a summer day which one knows to be bright behind the haze. And when I thus think of Lolita, I seem always to pick out for special delectation such images as Mr. Taxovich, or that class list of RamsVladimir Nabokov — Lolita 211 dale School, or Charlotte saying “waterproof,” or Lolita in slow motion advancing toward Humbert’s gifts, or the pictures decorating the stylized garret of Gaston Godin, or the Kasbeam barber (who cost me a month of work), or Lolita playing tennis, or the hospital at Elphinstone, or pale, pregnant, beloved, irretrievable Dolly Schiller dying in Gray Star (the capital town of the book), or the tinkling sounds of the valley town coming up the mountain trail (on which I caught the firstknownfemaleofLycaeides sublivens Nabokov). Thesearethenervesofthenovel.Thesearethesecretpoints, the subliminal co-ordinates by means of which the book is plotted — although I realize very clearly that these and other scenes will be skimmed over or not noticed, or never even reached, by those who begin reading the book under the impression that it is something on the lines of Memoirs of a Woman of Pleasure or Les Amours de Milord Grosvit. Thatmynoveldoescontainvariousallusionstothephysiologicalurgesof a pervert is quite true. But after all we are not children, not illiterate juvenile delinquents, not English public school boys who after a night of homosexual romps have to endure the paradox of reading the Ancients in expurgated versions. It is childish to study a work of fictioninordertogaininformationaboutacountry or about a social class or about the author. And yet one of my very few intimate friends, after reading Lolita, was sincerely worried that I (I!) should be living “among such depressing people” — when the only discomfort I really experienced was to live in my workshop among discarded limbs and unfinishedtorsos. After Olympia Press, in Paris, published the book, an American critic suggested that Lolita was the record of my love affairwiththeromanticnovel.Thesubstitution“English language” for “romantic novel” would make this elegant formula more correct. But here I feel my voice rising to a much too strident pitch. None of my American friends have read my Russian books and thus every appraisal on the strength of my English ones is bound to be out of focus. My private tragedy, which cannot, and indeed should not, be anybody’s concern, is that I had to abandon my natural idiom, my untrammeled, rich, and infinitelydocileRussiantongueforasecond-ratebrandof English, devoid of any of those apparatuses — the bafflingmirror,theblackvelvetbackdrop, the implied associations and traditions — which the native illusionist, frac-tails flying,canmagicallyusetotranscendtheheritageinhisownway. November ?2, ?956 Vladimir Vladimirovich Nabokov was born on April 23, ?899, in St. Petersburg, Russia. TheNabokovswereknownfortheirhighcultureandcommitment to public service, and the elder Nabokov was an outspoken opponent of antisemitism and one of the leaders of the opposition party, the Kadets. In ?9?9, following the Bolshevik revolution, he took his family into exile. Four years later he was shot and killed at a political rally in Berlin while trying to shield the speaker from right-wing assassins. TheNabokovhouseholdwastrilingual,andasachildNabokovwasalreadyreading Wells, Poe, Browning, Keats, Flaubert, Verlaine, Rimbaud, Tolstoy, and Chekhov, alongside the popular entertainments of Sir Arthur Conan Doyle and Jules Verne. As a young man, he studied Slavic and romance languages at Trinity College, Cambridge, taking his honors degree in ?922. For the next eighteen years he lived in Berlin and Paris, writing prolificallyinRussianunderthepseudonymSirinandsupportinghimself through translations, lessons in English and tennis, and by composing the firstcrossword puzzles in Russian. In ?925 he married Vera Slonim, with whom he had one child, a son, Dmitri. Having already fledRussiaandGermany,Nabokovbecamearefugeeoncemorein ?940, when he was forced to leave France for the United States. TherehetaughtatWellesley, Harvard, and Cornell. He also gave up writing in Russian and began composing fictioninEnglish.InhisafterwordtoLolita he claimed: „My private tragedy, which cannot, and indeed should not, be anybody’s concern, is that I had to abandon my natural idiom, my untrammeled, rich, and infinitelydocileRussiantongueforasecond-ratebrand of English, devoid of any of those apparatuses — the bafflingmirror,theblackvelvet backdrop, the implied associations and traditions — which the native illusionist, frac-tails flying,canmagicallyusetotranscendtheheritageinhisownway.”YetNabokov’s American period saw the creation of what are arguably his greatest works, Bend Sinister (?947), Lolita (?955), Pnin (?957), and Pale Fire (?962), as well as the translation of his earlier Russian novels into English. He also undertook English translations of works by Lermontov and Pushkin and wrote several books of criticism. Vladimir Nabokov died in Montreux, Switzerland, in ?977.

Compartir en redes sociales

Esta página ha sido visitada 238 veces.